Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PRKCA monoclonal antibody Western Blot analysis of PRKCA expression in HeLa.)

Mouse anti-Human PRKACA Monoclonal Antibody | anti-PRKACA antibody

PRKACA (Protein Kinase C alpha Type, AAG6, PKC-A, PKCA, PKC-alpha, MGC102831, MGC48865) (AP)

Gene Names
PRKCA; AAG6; PKCA; PRKACA; PKC-alpha
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKACA; Monoclonal Antibody; PRKACA (Protein Kinase C alpha Type; AAG6; PKC-A; PKCA; PKC-alpha; MGC102831; MGC48865) (AP); anti-PRKACA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F11
Specificity
Recognizes human PRKCA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PRKACA antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa563-672 from human PRKCA (NP_002728) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PRKCA monoclonal antibody Western Blot analysis of PRKCA expression in HeLa.)

Western Blot (WB) (PRKCA monoclonal antibody Western Blot analysis of PRKCA expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRKCA on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PRKCA on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PRKCA on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PRKCA on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRKCA is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRKCA is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FAS and PRKCA HeLa cells were stained with FAS rabbit purified polyclonal 1:1200 and PRKCA mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FAS and PRKCA HeLa cells were stained with FAS rabbit purified polyclonal 1:1200 and PRKCA mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-PRKACA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,750 Da
NCBI Official Full Name
protein kinase C alpha type
NCBI Official Synonym Full Names
protein kinase C, alpha
NCBI Official Symbol
PRKCA
NCBI Official Synonym Symbols
AAG6; PKCA; PRKACA; PKC-alpha
NCBI Protein Information
protein kinase C alpha type; PKC-A; aging-associated gene 6
UniProt Protein Name
Protein kinase C alpha type
UniProt Gene Name
PRKCA
UniProt Synonym Gene Names
PKCA; PRKACA; PKC-A; PKC-alpha
UniProt Entry Name
KPCA_HUMAN

Uniprot Description

PKCA: an AGC kinase of the PKC family. A classical PKC downstream of many mitogenic and receptors. Classical PKCs are calcium-dependent enzymes that are activated by phosphatidylserine, diacylglycerol and phorbol esters. Contains a pseudo-substrate autoinhibitory domain that binds to the catalytic domain preventing its activation in the absence of cofactors or activators.

Protein type: Oncoprotein; Protein kinase, AGC; Kinase, protein; EC 2.7.11.13; Protein kinase, Ser/Thr (non-receptor); AGC group; PKC family; Alpha subfamily

Chromosomal Location of Human Ortholog: 17q22-q23.2

Cellular Component: nucleoplasm; photoreceptor outer segment; cell soma; mitochondrion; perinuclear region of cytoplasm; endoplasmic reticulum; apical part of cell; cytoplasm; mitochondrial membrane; dendrite; plasma membrane; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; enzyme binding; protein kinase C activity; zinc ion binding; calcium-dependent protein kinase C activity; ATP binding; protein kinase activity

Biological Process: phototransduction, visible light; extracellular matrix organization and biogenesis; positive regulation of cell adhesion; nerve growth factor receptor signaling pathway; regulation of muscle contraction; positive regulation of lipopolysaccharide-mediated signaling pathway; mitotic nuclear envelope disassembly; negative regulation of insulin receptor signaling pathway; signal transduction; positive regulation of mitotic cell cycle; protein amino acid phosphorylation; induction of positive chemotaxis; negative regulation of cell proliferation; synaptic transmission; chondrocyte differentiation; angiogenesis; positive regulation of macrophage differentiation; cell adhesion; regulation of peptidyl-tyrosine phosphorylation; regulation of the force of heart contraction; inactivation of MAPK activity; epidermal growth factor receptor signaling pathway; neutrophil chemotaxis; platelet activation; fibroblast growth factor receptor signaling pathway; positive regulation of blood vessel endothelial cell migration; adenylate cyclase activation; negative regulation of adenylate cyclase activity; cellular calcium ion homeostasis; rhodopsin mediated signaling; positive regulation of angiogenesis; negative regulation of glucose import; regulation of rhodopsin mediated signaling; phospholipase C activation; energy reserve metabolic process; innate immune response; positive regulation of endothelial cell proliferation; gene expression; mitotic cell cycle; positive regulation of protein amino acid phosphorylation; blood coagulation; vascular endothelial growth factor receptor signaling pathway; regulation of insulin secretion; positive regulation of inflammatory response; positive regulation of cell migration

Similar Products

Product Notes

The PRKACA prkca (Catalog #AAA6133127) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRKACA (Protein Kinase C alpha Type, AAG6, PKC-A, PKCA, PKC-alpha, MGC102831, MGC48865) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKACA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKACA prkca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKACA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.