Testing Data
(Detection limit for recombinant GST tagged PRDX5 is ~0.3ng/ml as a capture antibody.)
Mouse anti-Human PRDX5 Monoclonal Antibody | anti-PRDX5 antibody
PRDX5 (Peroxiredoxin-5, Mitochondrial, Peroxiredoxin V, Prx-V, Peroxisomal Antioxidant Enzyme, PLP, Thioredoxin Reductase, Thioredoxin Peroxidase PMP20, Antioxidant Enzyme B166, AOEB166, TPx Type VI, Liver Tissue 2D-page Spot 71B, Alu Corepressor 1, SBBI1
Gene Names
PRDX5; PLP; ACR1; B166; PRXV; PMP20; PRDX6; prx-V; SBBI10; AOEB166; HEL-S-55
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRDX5; Monoclonal Antibody; PRDX5 (Peroxiredoxin-5; Mitochondrial; Peroxiredoxin V; Prx-V; Peroxisomal Antioxidant Enzyme; PLP; Thioredoxin Reductase; Thioredoxin Peroxidase PMP20; Antioxidant Enzyme B166; AOEB166; TPx Type VI; Liver Tissue 2D-page Spot 71B; Alu Corepressor 1; SBBI1; anti-PRDX5 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E6
Specificity
Recognizes human PRDX5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PRDX5 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa105-215 from human PRDX5 (NP_036226) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PRDX5 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PRDX5 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PRDX5 antibody
PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. This protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution.
Product Categories/Family for anti-PRDX5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,897 Da
NCBI Official Full Name
peroxiredoxin-5, mitochondrial isoform L
NCBI Official Synonym Full Names
peroxiredoxin 5
NCBI Official Symbol
PRDX5
NCBI Official Synonym Symbols
PLP; ACR1; B166; PRXV; PMP20; PRDX6; prx-V; SBBI10; AOEB166; HEL-S-55
NCBI Protein Information
peroxiredoxin-5, mitochondrial
UniProt Protein Name
Peroxiredoxin-5, mitochondrial
Protein Family
UniProt Gene Name
PRDX5
UniProt Synonym Gene Names
ACR1; AOEB166; Prx-V
UniProt Entry Name
PRDX5_HUMAN
NCBI Description
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene. [provided by RefSeq, Nov 2017]
Research Articles on PRDX5
Similar Products
Product Notes
The PRDX5 prdx5 (Catalog #AAA6133116) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRDX5 (Peroxiredoxin-5, Mitochondrial, Peroxiredoxin V, Prx-V, Peroxisomal Antioxidant Enzyme, PLP, Thioredoxin Reductase, Thioredoxin Peroxidase PMP20, Antioxidant Enzyme B166, AOEB166, TPx Type VI, Liver Tissue 2D-page Spot 71B, Alu Corepressor 1, SBBI1 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRDX5 prdx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRDX5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
