Mouse PQBP1 Monoclonal Antibody | anti-PQBP1 antibody

PQBP1 (polyglutamine Binding Protein 1, MRX55, MRXS3, MRXS8, NPW38, RENS1, SHS) (FITC)

Cat. Num. AAA6178084

• Gene Names: PQBP1; SHS; MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: PQBP1; Monoclonal Antibody; PQBP1 (polyglutamine Binding Protein 1; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS) (FITC); polyglutamine Binding Protein 1; SHS; anti-PQBP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H7
• Specificity: Recognizes PQBP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 265

• Applicable Applications for anti-PQBP1 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PQBP1 (AAH12358, 1aa-265aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PQBP1 is 0.03 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PQBP1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PQBP1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-PQBP1 antibody

PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain (Waragai et al., 1999 [PubMed 10332029]). [supplied by OMIM]

Product Categories/Family for anti-PQBP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15214469
• NCBI GeneID: 10084
• NCBI Official Full Name: Polyglutamine binding protein 1
• NCBI Official Synonym Full Names: polyglutamine binding protein 1
• NCBI Official Symbol: PQBP1
• NCBI Official Synonym Symbols: SHS; MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1
• NCBI Protein Information: polyglutamine-binding protein 1
• Protein Family: Polyglutamine-binding protein

NCBI Description

This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.[provided by RefSeq, Nov 2009]