Testing Data
(Detection limit for recombinant GST tagged PPP6C is 0.3ng/ml as a capture antibody.)
Mouse anti-Human PPP6C Monoclonal Antibody | anti-PPP6C antibody
PPP6C (PPP6, Serine/Threonine-protein Phosphatase 6 Catalytic Subunit, FLJ92648, MGC12249) (AP)
Gene Names
PPP6C; PP6; PP6C
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP6C; Monoclonal Antibody; PPP6C (PPP6; Serine/Threonine-protein Phosphatase 6 Catalytic Subunit; FLJ92648; MGC12249) (AP); anti-PPP6C antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B7
Specificity
Recognizes human PPP6C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PPP6C antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-306 from human PPP6C (AAH06990) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PPP6C is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PPP6C is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PPP6C antibody
This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X.
Product Categories/Family for anti-PPP6C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
38,947 Da
NCBI Official Full Name
Homo sapiens protein phosphatase 6, catalytic subunit, mRNA
NCBI Official Synonym Full Names
protein phosphatase 6, catalytic subunit
NCBI Official Symbol
PPP6C
NCBI Official Synonym Symbols
PP6; PP6C
NCBI Protein Information
serine/threonine-protein phosphatase 6 catalytic subunit; serine/threonine protein phosphatase catalytic subunit
Protein Family
NCBI Description
This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X. [provided by RefSeq, Jul 2008]
Research Articles on PPP6C
Similar Products
Product Notes
The PPP6C (Catalog #AAA6133108) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP6C (PPP6, Serine/Threonine-protein Phosphatase 6 Catalytic Subunit, FLJ92648, MGC12249) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP6C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP6C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP6C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
