Mouse PPP2R5D Monoclonal Antibody | anti-PPP2R5D antibody

PPP2R5D (Protein Phosphatase 2, Regulatory Subunit B', delta isoform, B56D, MGC2134, MGC8949) (Biotin)

Cat. Num. AAA6173619

• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: PPP2R5D; Monoclonal Antibody; PPP2R5D (Protein Phosphatase 2; Regulatory Subunit B'; delta isoform; B56D; MGC2134; MGC8949) (Biotin); Protein Phosphatase 2; MGC8949; anti-PPP2R5D antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A3
• Specificity: Recognizes PPP2R5D.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PPP2R5D antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PPP2R5D (NP_006236.1, 514aa-602aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PPP2R5D monoclonal antibody (M21), clone 1A3. Western Blot analysis of PPP2R5D expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged PPP2R5D is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PPP2R5D on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PPP2R5D on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-PPP2R5D antibody

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Product Categories/Family for anti-PPP2R5D antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 5453954
• NCBI GeneID: 5528
• NCBI Accession #: NP_006236.1
• NCBI GenBank Nucleotide #: NM_006245.3
• UniProt Accession #: Q14738; O00494; O00696; Q15171; Q5TC39; A8K3I9; B5BUA6
• Molecular Weight: 58,453 Da
• NCBI Official Full Name: serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform isoform 1
• UniProt Protein Name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
• Protein Family: Serine/threonine-protein phosphatase
• UniProt Gene Name: PPP2R5D
• UniProt Entry Name: 2A5D_HUMAN

NCBI Description

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PPP2R5D: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with SGOL1. By retinoic acid; in neuroblastoma cell lines. Isoform Delta-2 is widely expressed. Isoform Delta-1 is highly expressed in brain. Belongs to the phosphatase 2A regulatory subunit B56 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nucleoplasm; protein phosphatase type 2A complex; cytosol; nucleus

Molecular Function: protein binding; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity

Biological Process: nervous system development; glycolysis; nerve growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; glucose metabolic process; pathogenesis; toll-like receptor 3 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; dephosphorylation; regulation of catalytic activity; carbohydrate metabolic process; energy reserve metabolic process; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway

Disease: Mental Retardation, Autosomal Dominant 35