Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PPP1R10 Monoclonal Antibody | anti-PPP1R10 antibody

PPP1R10 (CAT53, FB19, PNUTS, Serine/Threonine-protein Phosphatase 1 Regulatory Subunit 10, MHC Class I Region Proline-rich Protein CAT53, PP1-binding Protein of 114kD, Phosphatase 1 Nuclear Targeting Subunit, Protein FB19, p99) (MaxLight 490)

Gene Names
PPP1R10; p99; FB19; R111; CAT53; PNUTS; PP1R10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP1R10; Monoclonal Antibody; PPP1R10 (CAT53; FB19; PNUTS; Serine/Threonine-protein Phosphatase 1 Regulatory Subunit 10; MHC Class I Region Proline-rich Protein CAT53; PP1-binding Protein of 114kD; Phosphatase 1 Nuclear Targeting Subunit; Protein FB19; p99) (MaxLight 490); anti-PPP1R10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D6
Specificity
Recognizes human PPP1R10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-PPP1R10 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-83 from human PPP1R10 (NP_002705.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PPP1R10 antibody
This gene encodes a protein with similarity to a rat protein that has an inhibitory effect on protein phosphatase-1 (PP1). The rat protein localizes to the nucleus and colocalizes with chromatin at distinct phases during mitosis. This gene lies within the major histocompatibility complex class I region on chromosome 6.
Product Categories/Family for anti-PPP1R10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99,058 Da
NCBI Official Full Name
serine/threonine-protein phosphatase 1 regulatory subunit 10
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory subunit 10
NCBI Official Symbol
PPP1R10
NCBI Official Synonym Symbols
p99; FB19; R111; CAT53; PNUTS; PP1R10
NCBI Protein Information
serine/threonine-protein phosphatase 1 regulatory subunit 10; HLA-C associated transcript 53; PP1-binding protein of 114 kDa; phosphatase 1 nuclear targeting subunit; MHC class I region proline-rich protein CAT53; protein phosphatase 1, regulatory (inhibi
UniProt Protein Name
Serine/threonine-protein phosphatase 1 regulatory subunit 10
UniProt Gene Name
PPP1R10
UniProt Synonym Gene Names
CAT53; FB19; PNUTS
UniProt Entry Name
PP1RA_HUMAN

NCBI Description

This gene encodes a protein phosphatase 1 binding protein. The encoded protein plays a role in many cellular processes including cell cycle progression, DNA repair and apoptosis by regulating the activity of protein phosphatase 1. This gene lies within the major histocompatibility complex class I region on chromosome 6, and alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

PNUTS: Scaffold protein which mediates the formation of the PTW/PP1 phosphatase complex by providing a binding platform to each component of the complex. The PTW/PP1 phosphatase complex plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Mediates interaction of WDR82 and PPP1CA. Inhibitor of PPP1CA and PPP1CC phosphatase activities. Has inhibitory activity on PPP1CA only when phosphorylated. Binds to mRNA, single-stranded DNA (ssDNA), poly(A) and poly(G) homopolymers.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; chromatin; nucleus

Molecular Function: DNA binding; metal ion binding; protein phosphatase inhibitor activity

Biological Process: transcription, DNA-dependent; protein import into nucleus; negative regulation of catalytic activity

Research Articles on PPP1R10

Similar Products

Product Notes

The PPP1R10 ppp1r10 (Catalog #AAA6202632) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP1R10 (CAT53, FB19, PNUTS, Serine/Threonine-protein Phosphatase 1 Regulatory Subunit 10, MHC Class I Region Proline-rich Protein CAT53, PP1-binding Protein of 114kD, Phosphatase 1 Nuclear Targeting Subunit, Protein FB19, p99) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R10 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP1R10 ppp1r10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP1R10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.