WB (Western Blot)
(WB Suggested Anti-FIBCD1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Rabbit FIBCD1 Polyclonal Antibody | anti-FIBCD1 antibody
FIBCD1 antibody - C-terminal region
Reactivity
Tested Reactivity: Human, MousePredicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FIBCD1, Antibody; FIBCD1 antibody - C-terminal region; anti-FIBCD1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human, Mouse
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY
Applicable Applications for anti-FIBCD1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (# AA)
461 amino acids
Protein Interactions
MAL; UBC;
Blocking Peptide
For anti-FIBCD1 (MBS3209806) antibody is Catalog #
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FIBCD1
Replacement Item
This antibody may replace item sc-136685 from Santa Cruz Biotechnology.
Predicted Homology
Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-FIBCD1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
WB (Western Blot)
(WB Suggested Anti-FIBCD1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
IHC (Immunohistochemistry)
(Sample Type :Adult mouse cortexPrimary Antibody Dilution :1:750Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: Fibcd1 Cyan: Nissl(Neurons)Gene Name :FIBCD1Submitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University)
IHC (Immunohistochemistry)
(Sample Type :Adult mouse cortexPrimary Antibody Dilution :1:750Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: Fibcd1 Cyan: Nissl(Neurons)Gene Name :FIBCD1Submitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University)
Related Product Information for anti-FIBCD1 antibody
This is a rabbit polyclonal antibody against FIBCD1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: FIBCD1 is a single-pass membrane protein. It contains 1 fibrinogen C-terminal domain. The exact function of FIBCD1 remains unknown.
Target Description: FIBCD1 is a single-pass membrane protein. It contains 1 fibrinogen C-terminal domain. The exact function of FIBCD1 remains unknown.
Product Categories/Family for anti-FIBCD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
fibrinogen C domain-containing protein 1
NCBI Official Synonym Full Names
fibrinogen C domain containing 1
NCBI Official Symbol
FIBCD1
NCBI Protein Information
fibrinogen C domain-containing protein 1
UniProt Protein Name
Fibrinogen C domain-containing protein 1
UniProt Gene Name
FIBCD1
UniProt Entry Name
FBCD1_HUMAN
Similar Products
Product Notes
The FIBCD1 fibcd1 (Catalog #AAA200069) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FIBCD1 antibody - C-terminal region reacts with Tested Reactivity: Human, Mouse Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FIBCD1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FIBCD1 fibcd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DGYPLTVADY SGTAGDSLLK HSGMRFTTKD RDSDHSENNC AAFYRGAWWY. It is sometimes possible for the material contained within the vial of "FIBCD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.