Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)

Mouse anti-Human PPIL4 Monoclonal Antibody | anti-PPIL4 antibody

PPIL4 (Peptidyl-prolyl Cis-trans Isomerase-like 4, PPIase, Cyclophilin-like Protein PPIL4, Rotamase PPIL4, HDCME13P) (MaxLight 550)

Gene Names
PPIL4; HDCME13P
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPIL4; Monoclonal Antibody; PPIL4 (Peptidyl-prolyl Cis-trans Isomerase-like 4; PPIase; Cyclophilin-like Protein PPIL4; Rotamase PPIL4; HDCME13P) (MaxLight 550); anti-PPIL4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C10
Specificity
Recognizes human PPIL4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-PPIL4 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa395-467 from human PPIL4 (NP_624311) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.03kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)

Western Blot (WB)

(Western Blot analysis of PPIL4 expression in Hela NE using 131664.)

Western Blot (WB) (Western Blot analysis of PPIL4 expression in Hela NE using 131664.)

Western Blot (WB)

(Western Blot analysis of PPIL4 expression in transfected 293T cell line by 131664. Lane 1: PPIL4 transfected lysate (57.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPIL4 expression in transfected 293T cell line by 131664. Lane 1: PPIL4 transfected lysate (57.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PPIL4 over-expressed 293 cell line, cotransfected with PPIL4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 131664. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PPIL4 over-expressed 293 cell line, cotransfected with PPIL4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 131664. GAPDH (36.1kD) used as specificity and loading control.)

Immunofluorescence (IF)

(Immunofluorescence of 131664 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of 131664 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-PPIL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59.4 kDa (512aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase-like 4
NCBI Official Synonym Full Names
peptidylprolyl isomerase like 4
NCBI Official Symbol
PPIL4
NCBI Official Synonym Symbols
HDCME13P
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase-like 4
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase-like 4
UniProt Gene Name
PPIL4
UniProt Synonym Gene Names
PPIase
UniProt Entry Name
PPIL4_HUMAN

NCBI Description

This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. [provided by RefSeq, Jul 2008]

Uniprot Description

PPIL4: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Belongs to the cyclophilin-type PPIase family. PPIL4 subfamily.

Protein type: Cyclophilin; EC 5.2.1.8; RNA-binding; Isomerase

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: nucleus

Molecular Function: peptidyl-prolyl cis-trans isomerase activity; nucleotide binding

Biological Process: protein peptidyl-prolyl isomerization; protein folding

Research Articles on PPIL4

Similar Products

Product Notes

The PPIL4 ppil4 (Catalog #AAA6213300) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPIL4 (Peptidyl-prolyl Cis-trans Isomerase-like 4, PPIase, Cyclophilin-like Protein PPIL4, Rotamase PPIL4, HDCME13P) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPIL4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPIL4 ppil4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPIL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.