Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human POU6F1 Monoclonal Antibody | anti-POU6F1 antibody

POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (Biotin)

Gene Names
POU6F1; BRN5; MPOU; TCFB1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POU6F1; Monoclonal Antibody; POU6F1 (BRN5; MPOU; TCFB1; POU Domain; Class 6; Transcription Factor 1; Brain-specific Homeobox/POU Domain Protein 5; mPOU Homeobox Protein) (Biotin); anti-POU6F1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6H1
Specificity
Recognizes human POU6F1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-POU6F1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa193-302 from human POU6F1 (NP_002693) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(POU6F1 monoclonal antibody Western Blot analysis of POU6F1 expression in Jurkat.)

Western Blot (WB) (POU6F1 monoclonal antibody Western Blot analysis of POU6F1 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of POU6F1 expression in transfected 293T cell line by POU6F1 monoclonal antibody. Lane 1: POU6F1 transfected lysate (32.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POU6F1 expression in transfected 293T cell line by POU6F1 monoclonal antibody. Lane 1: POU6F1 transfected lysate (32.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POU6F1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POU6F1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of POU6F1 over-expressed 293 cell line, cotransfected with POU6F1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POU6F1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of POU6F1 over-expressed 293 cell line, cotransfected with POU6F1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POU6F1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-POU6F1 antibody
Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3') (By similarity).
Product Categories/Family for anti-POU6F1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa (324aa), confirmed by MALDI-TOF
NCBI Official Synonym Full Names
POU class 6 homeobox 1
NCBI Official Symbol
POU6F1
NCBI Official Synonym Symbols
BRN5; MPOU; TCFB1
NCBI Protein Information
POU domain, class 6, transcription factor 1
UniProt Protein Name
POU domain, class 6, transcription factor 1
UniProt Gene Name
POU6F1
UniProt Synonym Gene Names
BRN5; MPOU; TCFB1; Brain-5; Brn-5
UniProt Entry Name
PO6F1_HUMAN

Uniprot Description

POU6F1: Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3'). Belongs to the POU transcription factor family. Class- 6 subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: nucleoplasm; nucleus; actin cytoskeleton

Molecular Function: DNA binding; transcription factor activity

Biological Process: muscle development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; heart development; brain development

Research Articles on POU6F1

Similar Products

Product Notes

The POU6F1 pou6f1 (Catalog #AAA6143679) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POU6F1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POU6F1 pou6f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POU6F1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.