Western Blot (WB)
(POU5F1 monoclonal antibody (M02), clone 4F8 Western Blot analysis of POU5F1 expression in HeLa (Cat # L013V1).)
Mouse POU5F1 Monoclonal Antibody | anti-POU5F1 antibody
POU5F1 (POU Class 5 Homeobox 1, MGC22487, OCT3, OCT4, OTF3, OTF4) (FITC)
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
POU5F1; Monoclonal Antibody; POU5F1 (POU Class 5 Homeobox 1; MGC22487; OCT3; OCT4; OTF3; OTF4) (FITC); POU Class 5 Homeobox 1; OTF4; anti-POU5F1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F8
Specificity
Recognizes POU5F1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-POU5F1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
POU5F1 (AAH20712, 81aa-164aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(POU5F1 monoclonal antibody (M02), clone 4F8 Western Blot analysis of POU5F1 expression in HeLa (Cat # L013V1).)
Western Blot (WB)
(POU5F1 monoclonal antibody (M02), clone 4F8 Western Blot analysis of POU5F1 expression in HeLa (Cat # L013V1).)
Western Blot (WB)
(Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M02), clone 4F8.Lane 1: POU5F1 transfected lysate (18.3 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M02), clone 4F8.Lane 1: POU5F1 transfected lysate (18.3 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-POU5F1 antibody
Mouse monoclonal antibody raised against a full length recombinant POU5F1.
Product Categories/Family for anti-POU5F1 antibody
NCBI and Uniprot Product Information
NCBI GI #
Protein Family
Similar Products
Product Notes
The POU5F1 (Catalog #AAA6176168) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's POU5F1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POU5F1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POU5F1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
