Mouse anti-Human POU4F3 Monoclonal Antibody | anti-POU4F3 antibody

POU4F3 (POU Domain, Class 4, Transcription Factor 3, Brain-specific Homeobox/POU Domain Protein 3C, Brain-3C, Brn-3C, BRN3C, MGC138412) (FITC)

Cat. Num. AAA6148980

• Gene Names: POU4F3; BRN3C; DFNA15; DFNA42; DFNA52
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POU4F3; Monoclonal Antibody; POU4F3 (POU Domain; Class 4; Transcription Factor 3; Brain-specific Homeobox/POU Domain Protein 3C; Brain-3C; Brn-3C; BRN3C; MGC138412) (FITC); anti-POU4F3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B8
• Specificity: Recognizes human POU4F3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-POU4F3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa100-191 from human POU4F3 (NP_002691) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(POU4F3 monoclonal antibody Western Blot analysis of POU4F3 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody. Lane 1: POU4F3 transfected lysate (37.1kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to POU4F3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged POU4F3 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-POU4F3 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4505965
• NCBI GeneID: 5459
• NCBI Accession #: NP_002691
• NCBI GenBank Nucleotide #: NM_002700
• UniProt Accession #: Q15319
• Molecular Weight: 37kDa
• NCBI Official Full Name: POU domain, class 4, transcription factor 3
• NCBI Official Synonym Full Names: POU class 4 homeobox 3
• NCBI Official Symbol: POU4F3
• NCBI Official Synonym Symbols: BRN3C; DFNA15; DFNA42; DFNA52
• NCBI Protein Information: POU domain, class 4, transcription factor 3
• UniProt Protein Name: POU domain, class 4, transcription factor 3
• Protein Family: POU domain, class 4, transcription factor
• UniProt Gene Name: POU4F3
• UniProt Synonym Gene Names: BRN3C; Brain-3C; Brn-3C
• UniProt Entry Name: PO4F3_HUMAN

NCBI Description

This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq, Mar 2009]

Uniprot Description

POU4F3: May play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in POU4F3 are the cause of deafness autosomal dominant type 15 (DFNA15). DFNA15 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the POU transcription factor family. Class- 4 subfamily.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: nucleoplasm

Molecular Function: transcription factor activity

Biological Process: vestibulocochlear nerve development; inner ear morphogenesis; neuron apoptosis; sensory perception of sound; visual perception; axon extension; auditory receptor cell differentiation; positive regulation of transcription from RNA polymerase II promoter; neuromuscular process controlling balance; retinal ganglion cell axon guidance

Disease: Deafness, Autosomal Dominant 15