Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human POU4F1 Monoclonal Antibody | anti-POU4F1 antibody

POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449) (AP)

Gene Names
POU4F1; BRN3A; RDC-1; Oct-T1; brn-3A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POU4F1; Monoclonal Antibody; POU4F1 (POU Domain; Class 4; Transcription Factor 1; Brain Specific Homeobox/POU Domain Protein 3A; BRN3A; Brn-3a; Brn-3.0; Brn3; FLJ13449; Homeobox/POU Domain Protein RDC1; Oct-T1; RDC-1; FLJ13449) (AP); anti-POU4F1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7B4
Specificity
Recognizes human POU4F1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-POU4F1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa331-421 from human POU4F1 (NP_006228) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(Western Blot analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody. Lane 1: POU4F1 transfected lysate (46.09kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody. Lane 1: POU4F1 transfected lysate (46.09kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POU4F1 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POU4F1 is 3ng/ml as a capture antibody.)
Related Product Information for anti-POU4F1 antibody
Brn-3C may play a role in determining or maintaining the identities of a small subset of visual system neurons. It is expressed in the brain and it seems to be specific to the retina. Defects in Brn-3C are the cause of non-syndromic sensorineural deafness autosomal dominant type 15 (DFNA15) which is a form of sensorineural hearing loss. Sensorineuraldeafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
Product Categories/Family for anti-POU4F1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
POU domain, class 4, transcription factor 1
NCBI Official Synonym Full Names
POU class 4 homeobox 1
NCBI Official Symbol
POU4F1
NCBI Official Synonym Symbols
BRN3A; RDC-1; Oct-T1; brn-3A
NCBI Protein Information
POU domain, class 4, transcription factor 1
UniProt Protein Name
POU domain, class 4, transcription factor 1
UniProt Gene Name
POU4F1
UniProt Synonym Gene Names
BRN3A; RDC1; Brain-3A; Brn-3A
UniProt Entry Name
PO4F1_HUMAN

NCBI Description

This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervical tumors. A translocation of this gene is associated with some adult acute myeloid leukemias. [provided by RefSeq, Mar 2012]

Uniprot Description

POU4F1: Probable transcription factor which may play a role in the regulation of specific gene expression within a subset of neuronal lineages. May play a role in determining or maintaining the identities of a small subset of visual system neurons. Belongs to the POU transcription factor family. Class- 4 subfamily.

Protein type: DNA-binding; Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 13q31.1

Cellular Component: neuron projection; nuclear chromatin

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding

Biological Process: transcription from RNA polymerase II promoter; central nervous system neuron differentiation; trigeminal nerve development; positive regulation of apoptosis; negative regulation of transcription from RNA polymerase II promoter; habenula development; peripheral nervous system neuron development; cell migration in hindbrain; proprioception during equilibrioception; regulation of neurogenesis; synaptogenesis; suckling behavior; axonogenesis; neuron fate specification; mesoderm development; positive regulation of transcription from RNA polymerase II promoter; sensory system development; negative regulation of neuron apoptosis

Research Articles on POU4F1

Similar Products

Product Notes

The POU4F1 pou4f1 (Catalog #AAA6133070) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POU4F1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POU4F1 pou4f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POU4F1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.