Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human POLR2J Monoclonal Antibody | anti-POLR2J antibody

POLR2J (POLR2J1, DNA-directed RNA Polymerase II Subunit RPB11-a, DNA-directed RNA Polymerase II Subunit J-1, RNA Polymerase II 13.3kD Subunit, MGC71910) (MaxLight 490)

Gene Names
POLR2J; RPB11; RPB11A; RPB11m; hRPB14; POLR2J1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLR2J; Monoclonal Antibody; POLR2J (POLR2J1; DNA-directed RNA Polymerase II Subunit RPB11-a; DNA-directed RNA Polymerase II Subunit J-1; RNA Polymerase II 13.3kD Subunit; MGC71910) (MaxLight 490); anti-POLR2J antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A10
Specificity
Recognizes human POLR2J.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-POLR2J antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-118 from human POLR2J (AAH24165) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-POLR2J antibody
This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13.
Product Categories/Family for anti-POLR2J antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
13,293 Da
NCBI Official Full Name
Homo sapiens polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa, mRNA
NCBI Official Synonym Full Names
RNA polymerase II subunit J
NCBI Official Symbol
POLR2J
NCBI Official Synonym Symbols
RPB11; RPB11A; RPB11m; hRPB14; POLR2J1
NCBI Protein Information
DNA-directed RNA polymerase II subunit RPB11-a

NCBI Description

This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq, Jul 2008]

Research Articles on POLR2J

Similar Products

Product Notes

The POLR2J (Catalog #AAA6202590) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLR2J (POLR2J1, DNA-directed RNA Polymerase II Subunit RPB11-a, DNA-directed RNA Polymerase II Subunit J-1, RNA Polymerase II 13.3kD Subunit, MGC71910) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2J can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLR2J for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLR2J, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.