Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human POLR2A Monoclonal Antibody | anti-POLR2A antibody

POLR2A (DNA-directed RNA Polymerase II Subunit RPB1, RNA Polymerase II Subunit B1, DNA-directed RNA Polymerase II Subunit A, DNA-directed RNA Polymerase III Largest Subunit, RNA-directed RNA Polymerase II Subunit RPB1, POLR2, MGC75453) (MaxLight 405)

Gene Names
POLR2A; RPB1; RPO2; POLR2; POLRA; RPBh1; RPOL2; RpIILS; hsRPB1; hRPB220
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLR2A; Monoclonal Antibody; POLR2A (DNA-directed RNA Polymerase II Subunit RPB1; RNA Polymerase II Subunit B1; DNA-directed RNA Polymerase II Subunit A; DNA-directed RNA Polymerase III Largest Subunit; RNA-directed RNA Polymerase II Subunit RPB1; POLR2; MGC75453) (MaxLight 405); anti-POLR2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F17
Specificity
Recognizes human POLR2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-POLR2A antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human POLR2A (NP_000928) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCV
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-POLR2A antibody
POLR2A (DNA-directed RNA Polymerase II subunit RPB1; also subunit A) is a 200-220kD member of the RNA polymerase beta-chain family of proteins. It is ubiquitously expressed and represents the largest subunit of RNA polymerase II, the catalytic mechanism for the synthesis of mRNA. Human POLR2A is 1970aa in length. It contains an N-terminus with six RNA polymerase domains (aa15-1079), and a C-terminus (CTD) with 52 seven aa repeats (-YSPTSPS-) that serve as a platform for polymerase subunit interaction. When these sequences are hyperphosphorylated, this subunit is called RNA pol IIo; when hypophosphorylated, the subunit becomes RNA pol IIa. Isoforms exist that show a 60aa substitution for aa1-95, a 24aa substitution for aa1-445, and an Arg substitution for aa1498-1536. Full-length human and mouse POLR2A sequences differ by only one amino acid (Thr1856Ala).
Product Categories/Family for anti-POLR2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,641 Da
NCBI Official Full Name
DNA-directed RNA polymerase II subunit RPB1
NCBI Official Synonym Full Names
polymerase (RNA) II (DNA directed) polypeptide A, 220kDa
NCBI Official Symbol
POLR2A
NCBI Official Synonym Symbols
RPB1; RPO2; POLR2; POLRA; RPBh1; RPOL2; RpIILS; hsRPB1; hRPB220
NCBI Protein Information
DNA-directed RNA polymerase II subunit RPB1; DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kd subunit; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit; RNA polymerase II subunit B1; RNA-dir
UniProt Protein Name
DNA-directed RNA polymerase II subunit RPB1
UniProt Gene Name
POLR2A
UniProt Synonym Gene Names
POLR2; RNA polymerase II subunit B1
UniProt Entry Name
RPB1_HUMAN

Uniprot Description

POLR2A: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing. Acts as a RNA- dependent RNA polymerase when associated with small delta antigen of Hepatitis delta virus, acting both as a replicate and transcriptase for the viral RNA circular genome. Component of the RNA polymerase II (Pol II) complex consisting of 12 subunits. The phosphorylated C-terminal domain interacts with FNBP3 and SYNCRIP. Interacts with SAFB/SAFB1. Interacts with CCNL1 and MYO1C. Interacts with CCNL2 and SFRS19. Component of a complex which is at least composed of HTATSF1/Tat-SF1, the P-TEFb complex components CDK9 and CCNT1, RNA polymerase II, SUPT5H, and NCL/nucleolin. Interacts with PAF1. Interacts (via C-terminus) with FTSJD2, CTDSP1 and SCAF8. Interacts via the phosphorylated C-terminal domain with WDR82 and with SETD1A and SETD1B only in the presence of WDR82. Interacts with ATF7IP. When phosphorylated at 'Ser-5', interacts with MEN1; the unphosphorylated form, or phosphorylated at 'Ser-2' does not interact. Interacts with DDX5. Belongs to the RNA polymerase beta' chain family.

Protein type: Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; Transferase; EC 2.7.7.6; Transcription initiation complex; EC 2.7.7.48

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: nucleoplasm; nucleolus; DNA-directed RNA polymerase II, core complex; nucleus

Molecular Function: protein binding; RNA-directed RNA polymerase activity; DNA binding; DNA-directed RNA polymerase activity; ubiquitin protein ligase binding; metal ion binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; somatic stem cell maintenance; positive regulation of viral transcription; RNA splicing; DNA repair; positive regulation of RNA splicing; nuclear mRNA splicing, via spliceosome; mRNA capping; regulation of transcription, DNA-dependent; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; gene expression

Similar Products

Product Notes

The POLR2A polr2a (Catalog #AAA6191910) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLR2A (DNA-directed RNA Polymerase II Subunit RPB1, RNA Polymerase II Subunit B1, DNA-directed RNA Polymerase II Subunit A, DNA-directed RNA Polymerase III Largest Subunit, RNA-directed RNA Polymerase II Subunit RPB1, POLR2, MGC75453) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2A can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLR2A polr2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLR2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.