Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat PNN Monoclonal Antibody | anti-PNN antibody

PNN (DRS, MEMA, Pinin, 140kD Nuclear and Cell Adhesion-related Phosphoprotein, Desmosome-associated Protein, Domain-rich Serine Protein, Melanoma Metastasis Clone A Protein, Nuclear Protein SDK3, SR-like Protein) (MaxLight 405)

Gene Names
PNN; DRS; DRSP; SDK3; memA
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PNN; Monoclonal Antibody; PNN (DRS; MEMA; Pinin; 140kD Nuclear and Cell Adhesion-related Phosphoprotein; Desmosome-associated Protein; Domain-rich Serine Protein; Melanoma Metastasis Clone A Protein; Nuclear Protein SDK3; SR-like Protein) (MaxLight 405); anti-PNN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B4
Specificity
Recognizes human PNN. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PNN antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-301 from human PNN (NP_002678) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PNN antibody
Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Participates in the regulation of alternative pre-mRNA splicing. Associates to spliced mRNA within 60 nt upstream of the 5'-splice sites. Involved in the establishment and maintenance of epithelia cell-cell adhesion. Potential tumor suppressor for renal cell carcinoma.
Product Categories/Family for anti-PNN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
pinin
NCBI Official Synonym Full Names
pinin, desmosome associated protein
NCBI Official Symbol
PNN
NCBI Official Synonym Symbols
DRS; DRSP; SDK3; memA
NCBI Protein Information
pinin
UniProt Protein Name
Pinin
Protein Family
UniProt Gene Name
PNN
UniProt Synonym Gene Names
DRS; MEMA; DRS protein; DRSP
UniProt Entry Name
PININ_HUMAN

Uniprot Description

PNN: Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Participates in the regulation of alternative pre-mRNA splicing. Associates to spliced mRNA within 60 nt upstream of the 5'-splice sites. Involved in the establishment and maintenance of epithelia cell-cell adhesion. Potential tumor suppressor for renal cell carcinoma. Belongs to the pinin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Spliceosome; RNA-binding; RNA splicing; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q21.1

Cellular Component: nucleoplasm; desmosome; membrane; cytoplasm; plasma membrane; intermediate filament; nuclear speck; intercellular junction

Molecular Function: DNA binding; structural molecule activity

Biological Process: nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; regulation of transcription, DNA-dependent; cell adhesion

Research Articles on PNN

Similar Products

Product Notes

The PNN pnn (Catalog #AAA6191897) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PNN (DRS, MEMA, Pinin, 140kD Nuclear and Cell Adhesion-related Phosphoprotein, Desmosome-associated Protein, Domain-rich Serine Protein, Melanoma Metastasis Clone A Protein, Nuclear Protein SDK3, SR-like Protein) (MaxLight 405) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PNN can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PNN pnn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PNN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.