Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.89kD).)

Mouse anti-Human PMM2 Monoclonal Antibody | anti-PMM2 antibody

PMM2 (Phosphomannomutase 2, PMM 2) (PE)

Gene Names
PMM2; PMI; CDG1; CDGS; PMI1; CDG1a; PMM 2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PMM2; Monoclonal Antibody; PMM2 (Phosphomannomutase 2; PMM 2) (PE); anti-PMM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E9
Specificity
Recognizes human PMM2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PMM2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa47-112 from human PMM2 (NP_000294) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.89kD).)

Western Blot (WB)

(Western Blot analysis of PMM2 expression in transfected 293T cell line by PMM2 monoclonal antibody. Lane 1: PMM2 transfected lysate (28.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PMM2 expression in transfected 293T cell line by PMM2 monoclonal antibody. Lane 1: PMM2 transfected lysate (28.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PMM2 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PMM2 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PMM2 antibody
Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Product Categories/Family for anti-PMM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,428 Da
NCBI Official Full Name
phosphomannomutase 2
NCBI Official Synonym Full Names
phosphomannomutase 2
NCBI Official Symbol
PMM2
NCBI Official Synonym Symbols
PMI; CDG1; CDGS; PMI1; CDG1a; PMM 2
NCBI Protein Information
phosphomannomutase 2
UniProt Protein Name
Phosphomannomutase 2
Protein Family
UniProt Gene Name
PMM2
UniProt Synonym Gene Names
PMM 2
UniProt Entry Name
PMM2_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. [provided by RefSeq, Jul 2008]

Uniprot Description

PMM2: Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. Defects in PMM2 are the cause of congenital disorder of glycosylation type 1A (CDG1A); also known as carbohydrate-deficient glycoprotein syndrome type Ia (CDGS1A) or Jaeken syndrome. Congenital disorders of glycosylation are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation. They are characterized by under-glycosylated serum glycoproteins. CDG1A is an autosomal recessive disorder characterized by a severe encephalopathy with axial hypotonia, abnormal eye movement, and pronounced psychomotor retardation, as well as peripheral neuropathy, cerebellar hypoplasia, and retinitis pigmentosa. Patients show a peculiar distribution of subcutaneous fat, nipple retraction, and hypogonadism. Belongs to the eukaryotic PMM family.

Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; Isomerase; EC 5.4.2.8; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 16p13

Cellular Component: cell soma; cytosol

Molecular Function: phosphomannomutase activity

Biological Process: mannose biosynthetic process; cellular protein metabolic process; dolichol-linked oligosaccharide biosynthetic process; protein amino acid glycosylation; GDP-mannose biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Disease: Congenital Disorder Of Glycosylation, Type Ia

Research Articles on PMM2

Similar Products

Product Notes

The PMM2 pmm2 (Catalog #AAA6159539) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PMM2 (Phosphomannomutase 2, PMM 2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PMM2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PMM2 pmm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PMM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.