Mouse anti-Human PMEPA1 Monoclonal Antibody | anti-PMEPA1 antibody

PMEPA1 (Transmembrane Prostate Androgen-induced Protein, TMEPAI, Solid Tumor-associated 1 Protein, STAG1) (FITC)

Cat. Num. AAA6150140

• Gene Names: PMEPA1; STAG1; TMEPAI
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PMEPA1; Monoclonal Antibody; PMEPA1 (Transmembrane Prostate Androgen-induced Protein; TMEPAI; Solid Tumor-associated 1 Protein; STAG1) (FITC); anti-PMEPA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A12
• Specificity: Recognizes human TMEPAI.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PMEPA1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: ELISA: 1ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa181-281 from human TMEPAI (AAH15918) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged TMEPAI is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-PMEPA1 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16198474
• NCBI GeneID: 56937
• UniProt Accession #: Q969W9; Q5TDR6; Q8NER4; Q96B72; Q9UJD3
• Molecular Weight: 26,201 Da
• NCBI Official Full Name: Homo sapiens prostate transmembrane protein, androgen induced 1, mRNA
• NCBI Official Synonym Full Names: prostate transmembrane protein, androgen induced 1
• NCBI Official Symbol: PMEPA1
• NCBI Official Synonym Symbols: STAG1; TMEPAI
• NCBI Protein Information: protein TMEPAI
• UniProt Protein Name: Transmembrane prostate androgen-induced protein
• Protein Family: Protein
• UniProt Gene Name: PMEPA1
• UniProt Synonym Gene Names: STAG1; TMEPAI
• UniProt Entry Name: PMEPA_HUMAN

NCBI Description

This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

TMEPAI: Involved in down-regulation of the androgen receptor (AR). Enhances ubiquitination and proteasome-mediated degradation of AR, probably by recruiting NEDD4. Belongs to the PMEPA1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 20q13.31-q13.33

Cellular Component: Golgi membrane; early endosome membrane; integral to membrane; plasma membrane; endosome membrane

Molecular Function: protein binding; WW domain binding

Biological Process: transforming growth factor beta receptor signaling pathway; androgen receptor signaling pathway; negative regulation of transforming growth factor beta receptor signaling pathway