Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (43.78kD).)

Mouse PLXNA2 Monoclonal Antibody | anti-PLXNA2 antibody

PLXNA2 (Plexin A2, KIAA0463, OCT, PLXN2, Plexin-A2, Semaphorin Receptor OCT, FLJ11751, FLJ30634) APC

Gene Names
PLXNA2; OCT; PLXN2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLXNA2; Monoclonal Antibody; PLXNA2 (Plexin A2; KIAA0463; OCT; PLXN2; Plexin-A2; Semaphorin Receptor OCT; FLJ11751; FLJ30634) APC; anti-PLXNA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G5
Specificity
Recognizes human PLXNA2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1012
Applicable Applications for anti-PLXNA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-165 from human PLXNA2 (AAH32125) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (43.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (43.78kD).)

Western Blot (WB)

(PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in PC-12.)

Western Blot (WB) (PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in PC-12.)

Western Blot (WB)

(PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in HepG2)

Western Blot (WB) (PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in HepG2)

Western Blot (WB)

(PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in Raw 264.7.)

Western Blot (WB) (PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in Raw 264.7.)

Western Blot (WB)

(PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in NIH/3T3.)

Western Blot (WB) (PLXNA2 monoclonal antibody. Western Blot analysis of PLXNA2 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of PLXNA2 expression in transfected 293T cell line by PLXNA2 monoclonal antibody. Lane 1: PLXNA2 transfected lysate (Predicted MW: 18.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PLXNA2 expression in transfected 293T cell line by PLXNA2 monoclonal antibody. Lane 1: PLXNA2 transfected lysate (Predicted MW: 18.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PLXNA2 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PLXNA2 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PLXNA2 antibody
This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
Product Categories/Family for anti-PLXNA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens plexin A2, mRNA
NCBI Official Synonym Full Names
plexin A2
NCBI Official Symbol
PLXNA2
NCBI Official Synonym Symbols
OCT; PLXN2
NCBI Protein Information
plexin-A2
Protein Family

NCBI Description

This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. [provided by RefSeq, Jul 2008]

Research Articles on PLXNA2

Similar Products

Product Notes

The PLXNA2 (Catalog #AAA6138321) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLXNA2 (Plexin A2, KIAA0463, OCT, PLXN2, Plexin-A2, Semaphorin Receptor OCT, FLJ11751, FLJ30634) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLXNA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLXNA2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLXNA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.