Mouse anti-Human PLUNC Monoclonal Antibody | anti-PLUNC antibody
PLUNC (BPIFA1, BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Tracheal Epithelium-enriched Protein, V
Gene Names
BPIFA1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLUNC; Monoclonal Antibody; PLUNC (BPIFA1; BPI Fold-containing Family A Member 1; Lung-specific Protein X; Nasopharyngeal Carcinoma-related Protein; Palate Lung and Nasal Epithelium Clone Protein; Secretory Protein in Upper Respiratory Tracts; Tracheal Epithelium-enriched Protein; V; anti-PLUNC antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C1
Specificity
Recognizes human PLUNC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
1053
Applicable Applications for anti-PLUNC antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-257 from human PLUNC (AAH12549) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PLUNC antibody
May be involved in the airway inflammatory response after exposure to irritants. May be associated with tumor progression. May play a role in innate immune responses of the upper airways.
Product Categories/Family for anti-PLUNC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens palate, lung and nasal epithelium associated, mRNA
NCBI Official Synonym Full Names
BPI fold containing family A member 1
NCBI Official Symbol
BPIFA1
NCBI Official Synonym Symbols
LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5
NCBI Protein Information
BPI fold-containing family A member 1
NCBI Description
This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known. [provided by RefSeq, Aug 2014]
Research Articles on PLUNC
Similar Products
Product Notes
The PLUNC (Catalog #AAA6191879) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLUNC (BPIFA1, BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Tracheal Epithelium-enriched Protein, V reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLUNC can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLUNC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLUNC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
