Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PLD1 Monoclonal Antibody | anti-PLD1 antibody

PLD1 (Phospholipase D1, Choline Phosphatase 1, PLD 1, hPLD1, Phosphatidylcholine-hydrolyzing Phospholipase D1) (PE)

Gene Names
PLD1; CVDD
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLD1; Monoclonal Antibody; PLD1 (Phospholipase D1; Choline Phosphatase 1; PLD 1; hPLD1; Phosphatidylcholine-hydrolyzing Phospholipase D1) (PE); anti-PLD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F3
Specificity
Recognizes human PLD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1074
Applicable Applications for anti-PLD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa965-1075 from human PLD1 (NP_002653) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of PLD1 expression in transfected 293T cell line by PLD1 monoclonal antibody. Lane 1: PLD1 transfected lysate (124.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PLD1 expression in transfected 293T cell line by PLD1 monoclonal antibody. Lane 1: PLD1 transfected lysate (124.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLD1 antibody
Phosphatidylcholine (PC)-specific phospholipases D (PLDs; EC 3.1.4.4) catalyze the hydrolysis of PC to produce phosphatidic acid and choline. A range of agonists acting through G protein-coupled receptors and receptor tyrosine kinases stimulate this hydrolysis. PC-specific PLD activity has been implicated in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis (Hammond et al., 1995 [PubMed 8530346]).
Product Categories/Family for anti-PLD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phospholipase D1 isoform a
NCBI Official Synonym Full Names
phospholipase D1
NCBI Official Symbol
PLD1
NCBI Official Synonym Symbols
CVDD
NCBI Protein Information
phospholipase D1
UniProt Protein Name
Phospholipase D1
Protein Family
UniProt Gene Name
PLD1
UniProt Synonym Gene Names
PLD 1; hPLD1
UniProt Entry Name
PLD1_HUMAN

NCBI Description

This gene encodes a phosphatidylcholine-specific phospholipase which catalyzes the hydrolysis of phosphatidylcholine in order to yield phosphatidic acid and choline. The enzyme may play a role in signal transduction and subcellular trafficking. Alternative splicing results in multiple transcript variants with both catalytic and regulatory properties. [provided by RefSeq, Sep 2011]

Uniprot Description

PLD1: a phosphatidylcholine-hydrolyzing phospholipase. Activated by ADP-ribosylated Rho and protein kinase C. Implicated as a critical step in numerous cellular pathways including membrane trafficking and the regulation polymorphonuclear leukocyte degranulation and oxidant production. May be involved in the regulation of perinuclear intravesicular membrane traffic. Four splice-variant isoforms have been described.

Protein type: Phospholipase; Lipid Metabolism - glycerophospholipid; Motility/polarity/chemotaxis; EC 3.1.4.4; Lipid Metabolism - ether lipid

Chromosomal Location of Human Ortholog: 3q26

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; membrane; perinuclear region of cytoplasm; late endosome membrane; lysosomal membrane; endocytic vesicle; apical plasma membrane; endosome

Molecular Function: protein binding; phospholipase D activity; phosphoinositide binding

Biological Process: defense response to Gram-positive bacterium; phosphatidylglycerol biosynthetic process; small GTPase mediated signal transduction; phospholipid metabolic process; glycerophospholipid biosynthetic process; Ras protein signal transduction; phosphatidic acid biosynthetic process; chemotaxis; lipid catabolic process; regulation of microvillus biogenesis

Research Articles on PLD1

Similar Products

Product Notes

The PLD1 pld1 (Catalog #AAA6159511) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLD1 (Phospholipase D1, Choline Phosphatase 1, PLD 1, hPLD1, Phosphatidylcholine-hydrolyzing Phospholipase D1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLD1 pld1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.