Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human PLAA Monoclonal Antibody | anti-PLAA antibody

PLAA (Phospholipase A-2-activating Protein, PLA2P, PLAP, FLJ11281, FLJ12699)

Gene Names
PLAA; DOA1; PLAP; PLA2P
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PLAA; Monoclonal Antibody; PLAA (Phospholipase A-2-activating Protein; PLA2P; PLAP; FLJ11281; FLJ12699); Anti -PLAA (Phospholipase A-2-activating Protein; anti-PLAA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b Lambda
Clone Number
2C1
Specificity
Recognizes human PLAA.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL
Applicable Applications for anti-PLAA antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa639-738 from PLaa (NP_004244) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged PLAA is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PLAA is ~3ng/ml as a capture antibody.)
Related Product Information for anti-PLAA antibody
PLAA stimulates human neutrophil aggregation and release of lysosomal enzymes, superoxide, and eicosanoids. It plays an important role in the regulation of specific inflammatory processes connected to such diseases as inflammatory bowel disease, pancreatitis, rheumatoid arthritis, and cutaneous malignant melanoma.
Product Categories/Family for anti-PLAA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,157 Da
NCBI Official Full Name
phospholipase A-2-activating protein
NCBI Official Synonym Full Names
phospholipase A2-activating protein
NCBI Official Symbol
PLAA
NCBI Official Synonym Symbols
DOA1; PLAP; PLA2P
NCBI Protein Information
phospholipase A-2-activating protein; DOA1 homolog; phospholipase A2 activating protein
UniProt Protein Name
Phospholipase A-2-activating protein
UniProt Gene Name
PLAA
UniProt Synonym Gene Names
PLAP; PLA2P; PLAP
UniProt Entry Name
PLAP_HUMAN

Uniprot Description

Function: Involved in the maintenance of ubiquitin levels

By similarity.

Subunit structure: Interacts with ubiquitin. Interacts with VCP. Ref.11

Domain: The PUL domain is composed of 6 armadillo-like repeats and mediates the interaction with VCP C-terminus. Ref.12The PFU domain mediates interaction with ubiquitin. Ref.12

Sequence similarities: Belongs to the WD repeat PLAP family.Contains 6 ARM repeats.Contains 1 PFU domain.Contains 1 PUL domain.Contains 7 WD repeats.

Sequence caution: The sequence AAD03030.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAD42075.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAD42075.1 differs from that shown. Reason: Frameshift at position 698. The sequence BAA92105.1 differs from that shown. Reason: Erroneous termination at position 545. Translated as Gln.The sequence BAD97264.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence CAB42881.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence CAH72641.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on PLAA

Similar Products

Product Notes

The PLAA plaa (Catalog #AAA649979) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLAA (Phospholipase A-2-activating Protein, PLA2P, PLAP, FLJ11281, FLJ12699) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLAA can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PLAA plaa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KNIHIALATL ALNYSVCFHK DHNIEGKAQC LSLISTILEV VQDLEATFRL LVALGTLISD DSNAVQLAKS LGVDSQIKKY SSVSEPAKVS ECCRFILNLL. It is sometimes possible for the material contained within the vial of "PLAA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.