Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PKP4 is approximately 3ng/ml as a capture antibody.)

Mouse PKP4 Monoclonal Antibody | anti-PKP4 antibody

PKP4 (Plakophilin 4, FLJ31261, FLJ42243, p0071) (HRP)

Gene Names
PKP4; p0071
Applications
Western Blot
Purity
Purified
Synonyms
PKP4; Monoclonal Antibody; PKP4 (Plakophilin 4; FLJ31261; FLJ42243; p0071) (HRP); Plakophilin 4; p0071; anti-PKP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B11
Specificity
Recognizes PKP4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PKP4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PKP4 (NP_001005476, 12aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PKP4 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PKP4 is approximately 3ng/ml as a capture antibody.)
Product Categories/Family for anti-PKP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127kDa
NCBI Official Full Name
plakophilin-4 isoform b
NCBI Official Synonym Full Names
plakophilin 4
NCBI Official Symbol
PKP4
NCBI Official Synonym Symbols
p0071
NCBI Protein Information
plakophilin-4
UniProt Protein Name
Plakophilin-4
Protein Family
UniProt Gene Name
PKP4
UniProt Entry Name
PKP4_HUMAN

NCBI Description

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120(ctn)/plakophilin subfamily of Armadillo-like proteins, including CTNND1, CTNND2, PKP1, PKP2, PKP4, and ARVCF. PKP4 may be a component of desmosomal plaque and other adhesion plaques and is thought to be involved in regulating junctional plaque organization and cadherin function. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2015]

Uniprot Description

plakophilin 4: an armadillo-like protein of the beta-catenin family. A component of desmosomal plaques and other adhesion plaques and is thought to be involved in regulating junctional plaque organization and cadherin function. Two splice-variant isoforms have been described

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 2q24.1

Cellular Component: spindle pole; desmosome; internal side of plasma membrane; cytoskeleton; perinuclear region of cytoplasm; postsynaptic density; cytoplasm; plasma membrane; midbody; intercellular junction; spindle midzone

Molecular Function: protein binding

Biological Process: positive regulation of cytokinesis; regulation of cell adhesion; intercellular junction assembly; cell-cell adhesion; cell-cell signaling

Research Articles on PKP4

Similar Products

Product Notes

The PKP4 pkp4 (Catalog #AAA6181232) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PKP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PKP4 pkp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.