Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)

Mouse anti-Human PKIG Monoclonal Antibody | anti-PKIG antibody

PKIG (cAMP-dependent Protein Kinase Inhibitor gamma, PKI-gamma, MGC126458, MGC126459) (HRP)

Gene Names
PKIG; PKI-gamma
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PKIG; Monoclonal Antibody; PKIG (cAMP-dependent Protein Kinase Inhibitor gamma; PKI-gamma; MGC126458; MGC126459) (HRP); anti-PKIG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D9
Specificity
Recognizes human PKIG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
76
Applicable Applications for anti-PKIG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-77 from PKIG (NP_861521) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.47kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)
Related Product Information for anti-PKIG antibody
Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
Product Categories/Family for anti-PKIG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cAMP-dependent protein kinase inhibitor gamma
NCBI Official Synonym Full Names
cAMP-dependent protein kinase inhibitor gamma
NCBI Official Symbol
PKIG
NCBI Official Synonym Symbols
PKI-gamma
NCBI Protein Information
cAMP-dependent protein kinase inhibitor gamma
UniProt Protein Name
cAMP-dependent protein kinase inhibitor gamma
UniProt Gene Name
PKIG
UniProt Synonym Gene Names
PKI-gamma
UniProt Entry Name
IPKG_HUMAN

NCBI Description

This gene encodes a member of the protein kinase inhibitor family. Studies of a similar protein in mice suggest that this protein acts as a potent competitive cAMP-dependent protein kinase inhibitor, and is a predominant form of inhibitor in various tissues. The encoded protein may be involved in osteogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

PKIG: Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains. Belongs to the PKI family.

Protein type: Protein kinase, regulatory subunit; Inhibitor

Chromosomal Location of Human Ortholog: 20q12-q13.1

Cellular Component: cytoplasm; nucleus

Molecular Function: cAMP-dependent protein kinase inhibitor activity

Biological Process: negative regulation of protein import into nucleus; negative regulation of transcription from RNA polymerase II promoter; signal transduction

Research Articles on PKIG

Similar Products

Product Notes

The PKIG pkig (Catalog #AAA6154193) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PKIG (cAMP-dependent Protein Kinase Inhibitor gamma, PKI-gamma, MGC126458, MGC126459) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PKIG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PKIG pkig for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKIG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.