Testing Data
(Detection limit for recombinant GST tagged PKIB is 0.3 ng/ml as a capture antibody.)
Mouse PKIB Monoclonal Antibody | anti-PKIB antibody
PKIB (Protein Kinase (cAMP-Dependent, Catalytic) Inhibitor beta, FLJ23817, PRKACN2) (FITC)
Gene Names
PKIB; PRKACN2
Applications
Western Blot
Purity
Purified
Synonyms
PKIB; Monoclonal Antibody; PKIB (Protein Kinase (cAMP-Dependent; Catalytic) Inhibitor beta; FLJ23817; PRKACN2) (FITC); Protein Kinase (cAMP-Dependent; PRKACN2; anti-PKIB antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7F8
Specificity
Recognizes PKIB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PKIB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PKIB (NP_115860.1, 2aa-54aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PKIB is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PKIB is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-PKIB antibody
The protein encoded by this gene is a member of the cAMP-dependent protein kinase inhibitor family. Studies of a similar protein in rat suggest that this protein may interact with the catalytic subunit of cAMP-dependent protein kinase and act as a competitive inhibitor. At least three alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]
Product Categories/Family for anti-PKIB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
9,237 Da
NCBI Official Full Name
cAMP-dependent protein kinase inhibitor beta isoform 1
NCBI Official Synonym Full Names
cAMP-dependent protein kinase inhibitor beta
NCBI Official Symbol
PKIB
NCBI Official Synonym Symbols
PRKACN2
NCBI Protein Information
cAMP-dependent protein kinase inhibitor beta
UniProt Protein Name
cAMP-dependent protein kinase inhibitor beta
Protein Family
UniProt Gene Name
PKIB
UniProt Synonym Gene Names
PRKACN2; PKI-beta
UniProt Entry Name
IPKB_HUMAN
NCBI Description
This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Uniprot Description
PKIB: Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains. Belongs to the PKI family.
Protein type: Protein kinase, regulatory subunit; Inhibitor
Chromosomal Location of Human Ortholog: 6q22.31
Cellular Component: cytoplasm; nucleus
Molecular Function: cAMP-dependent protein kinase inhibitor activity
Research Articles on PKIB
Similar Products
Product Notes
The PKIB pkib (Catalog #AAA6178873) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PKIB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PKIB pkib for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKIB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
