Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse PIK3R6 Monoclonal Antibody | anti-PIK3R6 antibody

PIK3R6 (Phosphoinositide-3-Kinase, Regulatory Subunit 6, C17orf38, DKFZp666P158, FLJ34500, HsT41028, p84, p87(PIKAP), p87PIKAP) (AP)

Gene Names
PIK3R6; C17orf38; HsT41028; p87PIKAP; p84 PIKAP; p87(PIKAP)
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PIK3R6; Monoclonal Antibody; PIK3R6 (Phosphoinositide-3-Kinase; Regulatory Subunit 6; C17orf38; DKFZp666P158; FLJ34500; HsT41028; p84; p87(PIKAP); p87PIKAP) (AP); Phosphoinositide-3-Kinase; p87PIKAP; anti-PIK3R6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F18
Specificity
Recognizes PIK3R6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PIK3R6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PIK3R6 (NP_001010855, 661aa-754aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PIK3R6 antibody
Phosphoinositide 3-kinase gamma is a lipid kinase that produces the lipid second messenger phosphatidylinositol 3,4,5-trisphosphate. The kinase is composed of a catalytic subunit and one of several regulatory subunits, and is chiefly activated by G protein-coupled receptors. This gene encodes a regulatory subunit, and is distantly related to the phosphoinositide-3-kinase, regulatory subunit 5 gene which is located adjacent to this gene on chromosome 7. The orthologous protein in the mouse binds to both the catalytic subunit and to G(beta/gamma), and mediates activation of the kinase subunit downstream of G protein-coupled receptors. [provided by RefSeq]
Product Categories/Family for anti-PIK3R6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
phosphoinositide 3-kinase regulatory subunit 6 isoform 1
NCBI Official Synonym Full Names
phosphoinositide-3-kinase regulatory subunit 6
NCBI Official Symbol
PIK3R6
NCBI Official Synonym Symbols
C17orf38; HsT41028; p87PIKAP; p84 PIKAP; p87(PIKAP)
NCBI Protein Information
phosphoinositide 3-kinase regulatory subunit 6
UniProt Protein Name
Phosphoinositide 3-kinase regulatory subunit 6
UniProt Gene Name
PIK3R6
UniProt Synonym Gene Names
C17orf38; p84 PIKAP; p87PIKAP

NCBI Description

Phosphoinositide 3-kinase gamma is a lipid kinase that produces the lipid second messenger phosphatidylinositol 3,4,5-trisphosphate. The kinase is composed of a catalytic subunit and one of several regulatory subunits, and is chiefly activated by G protein-coupled receptors. This gene encodes a regulatory subunit, and is distantly related to the phosphoinositide-3-kinase, regulatory subunit 5 gene which is located adjacent to this gene on chromosome 7. The orthologous protein in the mouse binds to both the catalytic subunit and to G(beta/gamma), and mediates activation of the kinase subunit downstream of G protein-coupled receptors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

PIK3R6: Regulatory subunit of the PI3K gamma complex. Acts as an adapter to drive activation of PIK3CG by beta-gamma G protein dimers. The PIK3CG:PIK3R6 heterodimer is much less sensitive to beta-gamma G protein dimers than PIK3CG:PIK3R5 and its membrane recruitment and beta-gamma G protein dimer-dependent activation requires HRAS1 bound to PIK3CG. Recruits of the PI3K gamma complex to a PDE3B:RAPGEF3 signaling complex involved in angiogenesis; signaling seems to involve RRAS.

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: cytosol; membrane; phosphoinositide 3-kinase complex; plasma membrane

Molecular Function: 1-phosphatidylinositol-3-kinase regulator activity; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein binding

Biological Process: angiogenesis; G-protein coupled receptor signaling pathway; phosphatidylinositol biosynthetic process; phosphatidylinositol phosphorylation; phosphoinositide 3-kinase cascade; platelet activation; positive regulation of angiogenesis; positive regulation of MAP kinase activity; positive regulation of T cell differentiation; regulation of natural killer cell mediated cytotoxicity; regulation of phosphoinositide 3-kinase activity

Research Articles on PIK3R6

Similar Products

Product Notes

The PIK3R6 pik3r6 (Catalog #AAA6165878) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PIK3R6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3R6 pik3r6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3R6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.