Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PIK3CB Monoclonal Antibody | anti-PIK3CB antibody

PIK3CB (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit, beta Isoform, PI3-kinase p110 Subunit beta, PIK3CB, DKFZp779K1237, MGC133043) (FITC)

Gene Names
PIK3CB; PI3K; PIK3C1; P110BETA; PI3KBETA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIK3CB; Monoclonal Antibody; PIK3CB (Phosphatidylinositol-4; 5-bisphosphate 3-kinase Catalytic Subunit; beta Isoform; PI3-kinase p110 Subunit beta; DKFZp779K1237; MGC133043) (FITC); anti-PIK3CB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H2
Specificity
Recognizes human PIK3CB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PIK3CB antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa147-257 from human PIK3CB (NP_006210) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PIK3CB on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PIK3CB on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between HCK and PIK3CB HeLa cells were stained with HCK rabbit purified polyclonal 1:1200 and PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between HCK and PIK3CB HeLa cells were stained with HCK rabbit purified polyclonal 1:1200 and PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between HCK and PIK3CB. Huh7 cells were stained with HCK rabbit purified polyclonal 1:1200 and PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between HCK and PIK3CB. Huh7 cells were stained with HCK rabbit purified polyclonal 1:1200 and PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Product Categories/Family for anti-PIK3CB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123kDa
NCBI Official Full Name
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
NCBI Official Symbol
PIK3CB
NCBI Official Synonym Symbols
PI3K; PIK3C1; P110BETA; PI3KBETA
NCBI Protein Information
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform

NCBI Description

This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]

Research Articles on PIK3CB

Similar Products

Product Notes

The PIK3CB (Catalog #AAA6148865) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIK3CB (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit, beta Isoform, PI3-kinase p110 Subunit beta, PIK3CB, DKFZp779K1237, MGC133043) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3CB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3CB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3CB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.