Testing Data
(Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and PIK3CB HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Mouse PIK3CB Monoclonal Antibody | anti-PIK3CB antibody
PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide, DKFZp779K1237, MGC133043, PI3K, PI3KCB, PI3Kbeta, PIK3C1, p110-BETA) (PE)
Gene Names
PIK3CB; PI3K; PIK3C1; P110BETA; PI3KBETA
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PIK3CB; Monoclonal Antibody; PIK3CB (Phosphoinositide-3-Kinase; Catalytic; beta Polypeptide; DKFZp779K1237; MGC133043; PI3K; PI3KCB; PI3Kbeta; PIK3C1; p110-BETA) (PE); Phosphoinositide-3-Kinase; p110-BETA; anti-PIK3CB antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
10D5
Specificity
Recognizes PIK3CB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PIK3CB antibody
mmunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PIK3CB (NP_006210, 147aa-256aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and PIK3CB HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Testing Data
(Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and PIK3CB HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PIK3CB on HeLa cell. [antibody concentration 20 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PIK3CB on HeLa cell. [antibody concentration 20 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PIK3CB on HeLa cell. [antibody concentration 20 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PIK3CB on HeLa cell. [antibody concentration 20 ug/ml])
Related Product Information for anti-PIK3CB antibody
Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993 [PubMed 8246984]). [supplied by OMIM]
Product Categories/Family for anti-PIK3CB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
123kDa
NCBI Official Full Name
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
NCBI Official Symbol
PIK3CB
NCBI Official Synonym Symbols
PI3K; PIK3C1; P110BETA; PI3KBETA
NCBI Protein Information
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
Protein Family
NCBI Description
This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]
Research Articles on PIK3CB
Similar Products
Product Notes
The PIK3CB (Catalog #AAA6185946) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PIK3CB can be used in a range of immunoassay formats including, but not limited to, mmunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3CB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3CB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
