Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human, Rat PICK1 Monoclonal Antibody | anti-PICK1 antibody

PICK1 (Protein Interacting with PRKCA 1, Protein Interacting with C Kinase 1, Protein that Interacts with C Kinase 1, PICK-1, MGC15204, OTTHUMP00000028509, Protein Kinase C alpha Binding Protein, PRKCA Binding Protein, Prkcabp) APC

Gene Names
PICK1; PICK; PRKCABP
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PICK1; Monoclonal Antibody; PICK1 (Protein Interacting with PRKCA 1; Protein Interacting with C Kinase 1; Protein that Interacts with C Kinase 1; PICK-1; MGC15204; OTTHUMP00000028509; Protein Kinase C alpha Binding Protein; PRKCA Binding Protein; Prkcabp) APC; anti-PICK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G5
Specificity
Recognizes human PRKCABP. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2058
Applicable Applications for anti-PICK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa266-375 from PRKCABP (NP_036539) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(PRKCABP monoclonal antibody Western Blot analysis of PICK1 expression in rat brain.)

Western Blot (WB) (PRKCABP monoclonal antibody Western Blot analysis of PICK1 expression in rat brain.)

Testing Data

(Detection limit for recombinant GST tagged PICK1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PICK1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PICK1 antibody
The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-PICK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens protein interacting with PRKCA 1 (PICK1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
protein interacting with PRKCA 1
NCBI Official Symbol
PICK1
NCBI Official Synonym Symbols
PICK; PRKCABP
NCBI Protein Information
PRKCA-binding protein
UniProt Protein Name
PRKCA-binding protein
Protein Family
UniProt Gene Name
PICK1
UniProt Synonym Gene Names
PRKCABP
UniProt Entry Name
PICK1_HUMAN

NCBI Description

The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PICK1: Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate heteromeric ASIC1/ASIC3 channel.

Protein type: Cell development/differentiation; Ligand, receptor tyrosine kinase; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: presynaptic membrane; Golgi apparatus; postsynaptic membrane; neuron projection; cytoskeleton; mitochondrion; perinuclear region of cytoplasm; cytoplasm; plasma membrane; synapse; cell junction

Molecular Function: actin filament binding; protein C-terminus binding; identical protein binding; protein domain specific binding; protein binding; enzyme binding; G-protein-coupled receptor binding; protein kinase C binding; metal ion binding; ATPase activity; receptor binding

Biological Process: glial cell development; cellular response to glucose starvation; synaptic transmission; DNA methylation during gametogenesis; monoamine transport; positive regulation of receptor internalization; protein kinase C activation; retrograde vesicle-mediated transport, Golgi to ER; DNA methylation during embryonic development; neuronal ion channel clustering; protein amino acid phosphorylation; receptor clustering; protein targeting

Research Articles on PICK1

Similar Products

Product Notes

The PICK1 pick1 (Catalog #AAA6138243) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PICK1 (Protein Interacting with PRKCA 1, Protein Interacting with C Kinase 1, Protein that Interacts with C Kinase 1, PICK-1, MGC15204, OTTHUMP00000028509, Protein Kinase C alpha Binding Protein, PRKCA Binding Protein, Prkcabp) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PICK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PICK1 pick1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PICK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.