Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PHF1 monoclonal antibody (M05), clone 4F5 Western Blot analysis of PHF1 expression in A-431.)

Mouse PHF1 Monoclonal Antibody | anti-PHF1 antibody

PHF1 (PHD Finger Protein 1, MTF2L2, PCL1, PHF2) (APC)

Gene Names
PHF1; PCL1; PHF2; hPHF1; MTF2L2; TDRD19C
Applications
Western Blot
Purity
Purified
Synonyms
PHF1; Monoclonal Antibody; PHF1 (PHD Finger Protein 1; MTF2L2; PCL1; PHF2) (APC); PHD Finger Protein 1; PHF2; anti-PHF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F5
Specificity
Recognizes PHF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PHF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PHF1 (NP_077084, 2aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PHF1 monoclonal antibody (M05), clone 4F5 Western Blot analysis of PHF1 expression in A-431.)

Western Blot (WB) (PHF1 monoclonal antibody (M05), clone 4F5 Western Blot analysis of PHF1 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged PHF1 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PHF1 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PHF1 antibody
This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-PHF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
PHD finger protein 1 isoform b
NCBI Official Synonym Full Names
PHD finger protein 1
NCBI Official Symbol
PHF1
NCBI Official Synonym Symbols
PCL1; PHF2; hPHF1; MTF2L2; TDRD19C
NCBI Protein Information
PHD finger protein 1
UniProt Protein Name
PHD finger protein 1
Protein Family
UniProt Gene Name
PHF1
UniProt Synonym Gene Names
PCL1; Protein PHF1; hPHF1; hPCl1
UniProt Entry Name
PHF1_HUMAN

NCBI Description

This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

Uniprot Description

PHF1: Transcriptional repressor. May promote methylation of histone H3 on 'Lys-27' by the PRC2/EED-EZH2 complex. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; ESC/E(Z) complex; cytoplasm; microtubule organizing center; nucleus

Molecular Function: zinc ion binding; transcription factor activity; methylated histone residue binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of gene expression, epigenetic; gene expression; chromatin modification; response to DNA damage stimulus; regulation of gene expression, epigenetic

Research Articles on PHF1

Similar Products

Product Notes

The PHF1 phf1 (Catalog #AAA6167690) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PHF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHF1 phf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.