Mouse PGR Monoclonal Antibody | anti-PGR antibody

PGR (Progesterone Receptor, NR3C3, PR) (HRP)

Cat. Num. AAA6179716

• Gene Names: PGR; PR; NR3C3
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: PGR; Monoclonal Antibody; PGR (Progesterone Receptor; NR3C3; PR) (HRP); Progesterone Receptor; PR; anti-PGR antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C2
• Specificity: Recognizes PGR.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PGR antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PGR (NP_000917, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.5 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PGR on A-431 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PGR on A-431 cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(PGR monoclonal antibody (M04), clone 2C2 Western Blot analysis of PGR expression in A-431 (Cat # L015V1).)

Testing Data

(Detection limit for recombinant GST tagged PGR is approximately 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-PGR antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 110611914
• NCBI GeneID: 5241
• NCBI Accession #: NP_000917
• NCBI GenBank Nucleotide #: NM_000926
• UniProt Accession #: P06401; Q8TDS3; Q9UPF7; A7LQ08; A7X8B0; B4E3T0
• Molecular Weight: 87,747 Da
• NCBI Official Full Name: progesterone receptor isoform B
• NCBI Official Synonym Full Names: progesterone receptor
• NCBI Official Symbol: PGR
• NCBI Official Synonym Symbols: PR; NR3C3
• NCBI Protein Information: progesterone receptor; nuclear receptor subfamily 3 group C member 3
• UniProt Protein Name: Progesterone receptor
• Protein Family: Protein
• UniProt Gene Name: PGR
• UniProt Synonym Gene Names: NR3C3; PR
• UniProt Entry Name: PRGR_HUMAN

Uniprot Description

PR: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 11q22-q23

Cellular Component: nucleoplasm; mitochondrial outer membrane

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; enzyme binding; DNA binding; zinc ion binding; steroid hormone receptor activity; steroid binding; receptor binding

Biological Process: transcription initiation from RNA polymerase II promoter; progesterone receptor signaling pathway; cell-cell signaling; epithelial cell maturation; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; signal transduction; ovulation from ovarian follicle; regulation of epithelial cell proliferation

Disease: Progesterone Resistance