Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Mouse anti-Human PGK1 Monoclonal Antibody | anti-PGK1 antibody

PGK1 (PGKA, Phosphoglycerate Kinase 1, Cell Migration-inducing Gene 10 Protein, Primer Recognition Protein 2, MGC117307, MGC142128, MGC8947) (AP)

Gene Names
PGK1; PGKA; MIG10; HEL-S-68p
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PGK1; Monoclonal Antibody; PGK1 (PGKA; Phosphoglycerate Kinase 1; Cell Migration-inducing Gene 10 Protein; Primer Recognition Protein 2; MGC117307; MGC142128; MGC8947) (AP); anti-PGK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H4
Specificity
Recognizes human PGK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PGK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa321-418 from human PGK1 (NP_000282) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB)

(PGK1 monoclonal antibody. Western Blot analysis of PGK1 expression in HepG2.)

Western Blot (WB) (PGK1 monoclonal antibody. Western Blot analysis of PGK1 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged PGK1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PGK1 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-PGK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,429 Da
NCBI Official Full Name
phosphoglycerate kinase 1
NCBI Official Synonym Full Names
phosphoglycerate kinase 1
NCBI Official Symbol
PGK1
NCBI Official Synonym Symbols
PGKA; MIG10; HEL-S-68p
NCBI Protein Information
phosphoglycerate kinase 1
UniProt Protein Name
Phosphoglycerate kinase 1
Protein Family
UniProt Gene Name
PGK1
UniProt Synonym Gene Names
PGKA; PRP 2
UniProt Entry Name
PGK1_HUMAN

NCBI Description

The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. Additionally, this protein is secreted by tumor cells where it participates in angiogenesis by functioning to reduce disulfide bonds in the serine protease, plasmin, which consequently leads to the release of the tumor blood vessel inhibitor angiostatin. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Deficiency of the enzyme is associated with a wide range of clinical phenotypes hemolytic anemia and neurological impairment. Pseudogenes of this gene have been defined on chromosomes 19, 21 and the X chromosome. [provided by RefSeq, Jan 2014]

Uniprot Description

PGK1: an apparent multifunctional protein. A glycolytic enzyme and a polymerase alpha cofactor protein (primer recognition protein).

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Kinase, other; EC 2.7.2.3

Chromosomal Location of Human Ortholog: Xq13.3

Cellular Component: membrane; cytosol

Molecular Function: protein binding; phosphoglycerate kinase activity; ATP binding

Biological Process: glycolysis; epithelial cell differentiation; carbohydrate metabolic process; glucose metabolic process; pathogenesis; phosphorylation; gluconeogenesis

Disease: Phosphoglycerate Kinase 1 Deficiency

Research Articles on PGK1

Similar Products

Product Notes

The PGK1 pgk1 (Catalog #AAA6132898) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PGK1 (PGKA, Phosphoglycerate Kinase 1, Cell Migration-inducing Gene 10 Protein, Primer Recognition Protein 2, MGC117307, MGC142128, MGC8947) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PGK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGK1 pgk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.