Mouse anti-Human PEX12 Monoclonal Antibody | anti-PEX12 antibody

PEX12 (PAF3, Peroxisome Assembly Protein 12, Peroxin-12, Peroxisome Assembly Factor 3, PAF-3) (MaxLight 490)

Gene Names

PEX12; PAF-3; PBD3A

Reactivity

Human

Applications

FLISA

Purity

Purified by Protein A Affinity Chromatography.

Synonyms

PEX12; Monoclonal Antibody; PEX12 (PAF3; Peroxisome Assembly Protein 12; Peroxin-12; Peroxisome Assembly Factor 3; PAF-3) (MaxLight 490); anti-PEX12 antibody

Ordering
Cat. Num. AAA6202423 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Mouse

Reactivity

Human

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2G6

Specificity

Recognizes human PEX12.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Sequence Length

2602

Applicable Applications for anti-PEX12 antibody

FLISA

Application Notes

Applications are based on unconjugated antibody.

Immunogen

Full length recombinant corresponding to aa1-360 from human PEX12 (AAH31085) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN

Conjugate

MaxLight490

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-PEX12 antibody

MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

Product Categories/Family for anti-PEX12 antibody

Antibodies; Obesity Proteins

NCBI and Uniprot Product Information

NCBI GI #

22658424

NCBI GeneID

5193

NCBI Official Full Name

Homo sapiens peroxisomal biogenesis factor 12, mRNA

NCBI Official Synonym Full Names

peroxisomal biogenesis factor 12

NCBI Official Symbol

PEX12

NCBI Official Synonym Symbols

PAF-3; PBD3A

NCBI Protein Information

peroxisome assembly protein 12

Protein Family

Peroxisome assembly protein

NCBI Description

This gene belongs to the peroxin-12 family. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS). [provided by RefSeq, Oct 2008]

Research Articles on PEX12

1. the relative fraction of disease-causing alleles that occur in the coding and splice junction sequences of PEX12 gene.

Similar Products

Product Notes

The PEX12 (Catalog #AAA6202423) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PEX12 (PAF3, Peroxisome Assembly Protein 12, Peroxin-12, Peroxisome Assembly Factor 3, PAF-3) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEX12 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PEX12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PEX12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...