Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to PEX11B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Mouse anti-Human PEX11B Monoclonal Antibody | anti-PEX11B antibody

PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (HRP)

Gene Names
PEX11B; PEX14B; PEX11-BETA
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PEX11B; Monoclonal Antibody; PEX11B (Peroxisomal Membrane Protein 11B; Peroxin-11B; Peroxisomal Biogenesis Factor 11B; Protein PEX11 Homolog beta; PEX11-beta) (HRP); anti-PEX11B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D2
Specificity
Recognizes human PEX11B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PEX11B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-99 from PEX11B (NP_003837) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to PEX11B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to PEX11B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PEX11B is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PEX11B is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-PEX11B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,724 Da
NCBI Official Full Name
peroxisomal membrane protein 11B isoform 1
NCBI Official Synonym Full Names
peroxisomal biogenesis factor 11 beta
NCBI Official Symbol
PEX11B
NCBI Official Synonym Symbols
PEX14B; PEX11-BETA
NCBI Protein Information
peroxisomal membrane protein 11B
UniProt Protein Name
Peroxisomal membrane protein 11B
UniProt Gene Name
PEX11B
UniProt Synonym Gene Names
PEX11-beta
UniProt Entry Name
PX11B_HUMAN

NCBI Description

The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

PEX11B: Involved in peroxisomal proliferation. May regulate peroxisomes division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane. Belongs to the peroxin-11 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: peroxisomal membrane; integral to peroxisomal membrane; protein complex; membrane; mitochondrion; peroxisome

Molecular Function: protein binding; protein homodimerization activity

Biological Process: peroxisome fission; peroxisome organization and biogenesis; signal transduction; protein homooligomerization

Disease: Peroxisome Biogenesis Disorder 14b

Research Articles on PEX11B

Similar Products

Product Notes

The PEX11B pex11b (Catalog #AAA6154095) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEX11B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PEX11B pex11b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PEX11B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.