<
Western Blot (WB)
(Western Blot detection against Immunogen (36.56kD).)
Mouse anti-Human PELO Monoclonal Antibody | anti-PELO antibody
PELO (Protein Pelota Homolog, CGI-17) (PE)
Gene Names
PELO; CGI-17; PRO1770
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PELO; Monoclonal Antibody; PELO (Protein Pelota Homolog; CGI-17) (PE); anti-PELO antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C2
Specificity
Recognizes human PELO.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PELO antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa291-386 from human PELO (NP_057030) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.56kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.56kD).)
Western Blot (WB)
(Western Blot analysis of PELO expression in transfected 293T cell line by PELO monoclonal antibody. Lane 1: PELO transfected lysate (43.4kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PELO expression in transfected 293T cell line by PELO monoclonal antibody. Lane 1: PELO transfected lysate (43.4kD). Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of PELO transfected lysate using PELO monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PELO monoclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of PELO transfected lysate using PELO monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PELO monoclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged PELO is 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PELO is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-PELO antibody
PELO encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division.
Product Categories/Family for anti-PELO antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,359 Da
NCBI Official Full Name
protein pelota homolog
NCBI Official Synonym Full Names
pelota homolog (Drosophila)
NCBI Official Symbol
PELO
NCBI Official Synonym Symbols
CGI-17; PRO1770
NCBI Protein Information
protein pelota homolog
UniProt Protein Name
Protein pelota homolog
Protein Family
UniProt Gene Name
PELO
UniProt Entry Name
PELO_HUMAN
Similar Products
Product Notes
The PELO pelo (Catalog #AAA6159389) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PELO (Protein Pelota Homolog, CGI-17) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PELO can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PELO pelo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PELO, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
