Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PDE3B Monoclonal Antibody | anti-PDE3B antibody

PDE3B (cGMP-inhibited 3',5'-cyclic Phosphodiesterase B, CGIPDE1, Cyclic GMP-inhibited Phosphodiesterase B) (MaxLight 650)

Gene Names
PDE3B; HcGIP1; cGIPDE1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDE3B; Monoclonal Antibody; PDE3B (cGMP-inhibited 3'; 5'-cyclic Phosphodiesterase B; CGIPDE1; Cyclic GMP-inhibited Phosphodiesterase B) (MaxLight 650); anti-PDE3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A4
Specificity
Recognizes human PDE3B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-PDE3B antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa401-501 from human PDE3B (NP_000913) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PDE3B antibody
Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes; PDE3B may play a role in fat metabolism.
Product Categories/Family for anti-PDE3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124kDa
NCBI Official Full Name
cGMP-inhibited 3',5'-cyclic phosphodiesterase B isoform 2
NCBI Official Synonym Full Names
phosphodiesterase 3B
NCBI Official Symbol
PDE3B
NCBI Official Synonym Symbols
HcGIP1; cGIPDE1
NCBI Protein Information
cGMP-inhibited 3',5'-cyclic phosphodiesterase B
UniProt Protein Name
cGMP-inhibited 3',5'-cyclic phosphodiesterase B
UniProt Gene Name
PDE3B
UniProt Synonym Gene Names
CGIP1; CGI-PDE B
UniProt Entry Name
PDE3B_HUMAN

Research Articles on PDE3B

Similar Products

Product Notes

The PDE3B pde3b (Catalog #AAA6223738) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDE3B (cGMP-inhibited 3',5'-cyclic Phosphodiesterase B, CGIPDE1, Cyclic GMP-inhibited Phosphodiesterase B) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE3B can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDE3B pde3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDE3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.