Western Blot (WB)
(PCTP monoclonal antibody (M03), clone 3A11 Western Blot analysis of PCTP expression in HepG2.)
Mouse PCTP Monoclonal Antibody | anti-PCTP antibody
PCTP (phosphatidylcholine transfer Protein, STARD2) (AP)
Gene Names
PCTP; PC-TP; STARD2
Applications
Western Blot
Purity
Purified
Synonyms
PCTP; Monoclonal Antibody; PCTP (phosphatidylcholine transfer Protein; STARD2) (AP); phosphatidylcholine transfer Protein; STARD2; anti-PCTP antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A11
Specificity
Recognizes PCTP.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
214
Applicable Applications for anti-PCTP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PCTP (NP_067036, 106aa-214aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(PCTP monoclonal antibody (M03), clone 3A11 Western Blot analysis of PCTP expression in HepG2.)
Western Blot (WB)
(PCTP monoclonal antibody (M03), clone 3A11 Western Blot analysis of PCTP expression in HepG2.)
Testing Data
(Detection limit for recombinant GST tagged PCTP is approximately 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PCTP is approximately 3ng/ml as a capture antibody.)
Western Blot (WB)
(PCTP monoclonal antibody (M03), clone 3A11. Western Blot analysis of PCTP expression in human liver.)
Western Blot (WB)
(PCTP monoclonal antibody (M03), clone 3A11. Western Blot analysis of PCTP expression in human liver.)
Related Product Information for anti-PCTP antibody
Mouse monoclonal antibody raised against a partial recombinant PCTP.
Product Categories/Family for anti-PCTP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phosphatidylcholine transfer protein isoform 1
NCBI Official Synonym Full Names
phosphatidylcholine transfer protein
NCBI Official Symbol
PCTP
NCBI Official Synonym Symbols
PC-TP; STARD2
NCBI Protein Information
phosphatidylcholine transfer protein
UniProt Protein Name
Phosphatidylcholine transfer protein
Protein Family
UniProt Gene Name
PCTP
UniProt Synonym Gene Names
STARD2; PC-TP; StARD2
UniProt Entry Name
PPCT_HUMAN
Uniprot Description
PCTP: Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 17q21-q24
Cellular Component: cytosol
Molecular Function: phosphatidylcholine transmembrane transporter activity; phosphatidylcholine binding
Biological Process: cholesterol metabolic process; phospholipid transport; lipid transport
Research Articles on PCTP
Similar Products
Product Notes
The PCTP pctp (Catalog #AAA6163627) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PCTP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCTP pctp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCTP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
