Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human PCSK2 Monoclonal Antibody | anti-PCSK2 antibody

PCSK2 (Neuroendocrine Convertase 2, NEC 2, KEX2-like Endoprotease 2, Prohormone Convertase 2, Proprotein Convertase 2, PC2, NEC2) APC

Gene Names
PCSK2; PC2; NEC2; SPC2; NEC 2; NEC-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCSK2; Monoclonal Antibody; PCSK2 (Neuroendocrine Convertase 2; NEC 2; KEX2-like Endoprotease 2; Prohormone Convertase 2; Proprotein Convertase 2; PC2; NEC2) APC; anti-PCSK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H4
Specificity
Recognizes human PCSK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PCSK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa501-610 from human PCSK2 (NP_002585) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Testing Data

(Detection limit for recombinant GST tagged PCSK2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCSK2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PCSK2 antibody
PCSK2 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This protein is a proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. The protein is also known to cleave proopiomelanocortin, proenkephalin, prodynorphin and proluteinizing-hormone-releasing hormone.
Product Categories/Family for anti-PCSK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
neuroendocrine convertase 2 isoform 1 preproprotein
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 2
NCBI Official Symbol
PCSK2
NCBI Official Synonym Symbols
PC2; NEC2; SPC2; NEC 2; NEC-2
NCBI Protein Information
neuroendocrine convertase 2
UniProt Protein Name
Neuroendocrine convertase 2
Protein Family
UniProt Gene Name
PCSK2
UniProt Synonym Gene Names
NEC2; NEC 2; PC2

NCBI Description

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The protein undergoes an initial autocatalytic processing event and interacts with a neuroendocrine secretory protein in the ER, exits the ER and sorts to secretory granules, where it is cleaved and catalytically activated during intracellular transport. The encoded protease is packaged into and activated in dense core secretory granules and expressed in the neuroendocrine system and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. It functions in the proteolytic activation of polypeptide hormones and neuropeptides precursors. Single nucleotide polymorphisms in this gene may increase susceptibility to myocardial infarction and type 2 diabetes. This gene may also play a role in tumor development and progression. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2014]

Uniprot Description

Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells ().

Research Articles on PCSK2

Similar Products

Product Notes

The PCSK2 pcsk2 (Catalog #AAA6138137) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCSK2 (Neuroendocrine Convertase 2, NEC 2, KEX2-like Endoprotease 2, Prohormone Convertase 2, Proprotein Convertase 2, PC2, NEC2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCSK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCSK2 pcsk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCSK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.