Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to PCGF3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Mouse anti-Human PCGF3 Monoclonal Antibody | anti-PCGF3 antibody

PCGF3 (RING Finger Protein 3, RNF3, RING Finger Protein 3A, RNF3A, DONG1, Polycomb Group RING Finger Protein 3) (HRP)

Gene Names
PCGF3; RNF3; DONG1; RNF3A
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCGF3; Monoclonal Antibody; PCGF3 (RING Finger Protein 3; RNF3; RING Finger Protein 3A; RNF3A; DONG1; Polycomb Group RING Finger Protein 3) (HRP); anti-PCGF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F1
Specificity
Recognizes human PCGF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
5958
Applicable Applications for anti-PCGF3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa133-242 from PCGF3 (NP_006306) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to PCGF3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to PCGF3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PCGF3 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCGF3 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-PCGF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens polycomb group ring finger 3 (PCGF3), transcript variant 2, mRNA
NCBI Official Synonym Full Names
polycomb group ring finger 3
NCBI Official Symbol
PCGF3
NCBI Official Synonym Symbols
RNF3; DONG1; RNF3A
NCBI Protein Information
polycomb group RING finger protein 3
UniProt Protein Name
Polycomb group RING finger protein 3
UniProt Gene Name
PCGF3
UniProt Synonym Gene Names
RNF3; RNF3A

NCBI Description

The protein encoded by this gene contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PCGF3: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: nucleoplasm; nucleus; PcG protein complex; X chromosome

Molecular Function: metal ion binding; protein binding

Biological Process: regulation of transcription, DNA-templated; transcription, DNA-dependent

Research Articles on PCGF3

Similar Products

Product Notes

The PCGF3 pcgf3 (Catalog #AAA6154034) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCGF3 (RING Finger Protein 3, RNF3, RING Finger Protein 3A, RNF3A, DONG1, Polycomb Group RING Finger Protein 3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCGF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCGF3 pcgf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCGF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.