Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human PCDHGC5 Monoclonal Antibody | anti-PCDHGC5 antibody

PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (HRP)

Gene Names
PCDHGC5; PCDH-GAMMA-C5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCDHGC5; Monoclonal Antibody; PCDHGC5 (Protocadherin gamma-C5; PCDH-gamma-C5; MGC138286; MGC138288; PCDH-GAMMA-C5) (HRP); anti-PCDHGC5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A6
Specificity
Recognizes human PCDHGC5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PCDHGC5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa467-576 from human PCDHGC5 (NP_061752) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGAPASSFVYVNPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNAPAVLHPRPDWEHSA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of PCDHGC5 expression in transfected 293T cell line by PCDHGC5 monoclonal antibody. Lane 1: PCDHGC5 transfected lysate (95.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PCDHGC5 expression in transfected 293T cell line by PCDHGC5 monoclonal antibody. Lane 1: PCDHGC5 transfected lysate (95.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PCDHGC5 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCDHGC5 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PCDHGC5 antibody
This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Product Categories/Family for anti-PCDHGC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95,193 Da
NCBI Official Full Name
protocadherin gamma-C5 isoform 1
NCBI Official Synonym Full Names
protocadherin gamma subfamily C, 5
NCBI Official Symbol
PCDHGC5
NCBI Official Synonym Symbols
PCDH-GAMMA-C5
NCBI Protein Information
protocadherin gamma-C5
UniProt Protein Name
Protocadherin gamma-C5
Protein Family
UniProt Gene Name
PCDHGC5
UniProt Synonym Gene Names
PCDH-gamma-C5
UniProt Entry Name
PCDGM_HUMAN

Similar Products

Product Notes

The PCDHGC5 pcdhgc5 (Catalog #AAA6154031) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCDHGC5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCDHGC5 pcdhgc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCDHGC5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.