Testing Data
(Detection limit for recombinant GST tagged PCDHA7 is 0.3 ng/ml as a capture antibody.)
Mouse PCDHA7 Monoclonal Antibody | anti-PCDHA7 antibody
PCDHA7 (Protocadherin alpha 7, CNR4, CNRN4, CNRS4, CRNR4, PCDH-ALPHA7) (APC)
Applications
Western Blot
Purity
Purified
Synonyms
PCDHA7; Monoclonal Antibody; PCDHA7 (Protocadherin alpha 7; CNR4; CNRN4; CNRS4; CRNR4; PCDH-ALPHA7) (APC); Protocadherin alpha 7; PCDH-ALPHA7; anti-PCDHA7 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G3
Specificity
Recognizes PCDHA7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
937
Applicable Applications for anti-PCDHA7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PCDHA7 (NP_061733, 143aa-241aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PCDHA7 is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PCDHA7 is 0.3 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of PCDHA7 expression in transfected 293T cell line by PCDHA7 monoclonal antibody (M10), clone 4G3.Lane 1: PCDHA7 transfected lysate (Predicted MW: 100.9 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PCDHA7 expression in transfected 293T cell line by PCDHA7 monoclonal antibody (M10), clone 4G3.Lane 1: PCDHA7 transfected lysate (Predicted MW: 100.9 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PCDHA7 antibody
This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. [provided by RefSeq]
Product Categories/Family for anti-PCDHA7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protocadherin alpha-7 isoform 1
UniProt Protein Name
Protocadherin alpha-7
Protein Family
UniProt Gene Name
PCDHA7
UniProt Synonym Gene Names
CNRS4
UniProt Entry Name
PCDA7_HUMAN
Uniprot Description
PCDHA7: Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q31
Cellular Component: integral to plasma membrane
Molecular Function: calcium ion binding
Biological Process: nervous system development; cell adhesion; homophilic cell adhesion
Similar Products
Product Notes
The PCDHA7 pcdha7 (Catalog #AAA6168999) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PCDHA7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCDHA7 pcdha7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCDHA7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
