Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Mouse anti-Human PCDH20 Monoclonal Antibody | anti-PCDH20 antibody
PCDH20 (Protocadherin-20, Protocadherin-13, PCDH13, FLJ22218)
Gene Names
PCDH20; PCDH13
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PCDH20; Monoclonal Antibody; PCDH20 (Protocadherin-20; Protocadherin-13; PCDH13; FLJ22218); Anti -PCDH20 (Protocadherin-20; anti-PCDH20 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Specificity
Recognizes human PCDH20.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RPPEIVPRYIANEIDGVVYLKELEPVNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPYKPYNNEYLLETTKPMDYELQQFYEVAVVAWNSEGFHVKRVI
Applicable Applications for anti-PCDH20 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa395-495 from human PCDH20 (NP_073754) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Testing Data
(Detection limit for recombinant GST tagged PCDH20 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PCDH20 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-PCDH20 antibody
Potential calcium-dependent cell-adhesion protein.
Product Categories/Family for anti-PCDH20 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
104,919 Da
NCBI Official Full Name
protocadherin-20
NCBI Official Synonym Full Names
protocadherin 20
NCBI Official Symbol
PCDH20
NCBI Official Synonym Symbols
PCDH13
NCBI Protein Information
protocadherin-20; protocadherin 13; protocadherin-13
UniProt Protein Name
Protocadherin-20
Protein Family
UniProt Gene Name
PCDH20
UniProt Synonym Gene Names
PCDH13
UniProt Entry Name
PCD20_HUMAN
NCBI Description
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. This gene encodes a protein which contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. Although its specific function is undetermined, the cadherin-related neuronal receptor is thought to play a role in the establishment and function of specific cell-cell connections in the brain. [provided by RefSeq, Jul 2008]
Uniprot Description
PCDH20: Potential calcium-dependent cell-adhesion protein.
Protein type: Cell adhesion; Membrane protein, integral
Chromosomal Location of Human Ortholog: 13q21
Cellular Component: plasma membrane; integral to membrane
Molecular Function: calcium ion binding
Biological Process: homophilic cell adhesion
Similar Products
Product Notes
The PCDH20 pcdh20 (Catalog #AAA6000544) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCDH20 (Protocadherin-20, Protocadherin-13, PCDH13, FLJ22218) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCDH20 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PCDH20 pcdh20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RPPEIVPRYI ANEIDGVVYL KELEPVNTPI AFFTIRDPEG KYKVNCYLDG EGPFRLSPYK PYNNEYLLET TKPMDYELQQ FYEVAVVAWN SEGFHVKRVI. It is sometimes possible for the material contained within the vial of "PCDH20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
