Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PBX3 monoclonal antibody (M02), clone 1A11 Western Blot analysis of PBX3 expression in K-562.)

Mouse PBX3 Monoclonal Antibody | anti-PBX3 antibody

PBX3 (pre-B-Cell Leukemia Homeobox 3) (AP)

Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
PBX3; Monoclonal Antibody; PBX3 (pre-B-Cell Leukemia Homeobox 3) (AP); pre-B-Cell Leukemia Homeobox 3; anti-PBX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A11
Specificity
Recognizes PBX3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PBX3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PBX3 (NP_006186, 342aa-434aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PBX3 monoclonal antibody (M02), clone 1A11 Western Blot analysis of PBX3 expression in K-562.)

Western Blot (WB) (PBX3 monoclonal antibody (M02), clone 1A11 Western Blot analysis of PBX3 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged PBX3 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PBX3 is approximately 1ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.2 ug/ml])
Related Product Information for anti-PBX3 antibody
Mouse monoclonal antibody raised against a partial recombinant PBX3.
Product Categories/Family for anti-PBX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
pre-B-cell leukemia transcription factor 3 isoform 1
NCBI Official Synonym Full Names
PBX homeobox 3
NCBI Official Symbol
PBX3
NCBI Protein Information
pre-B-cell leukemia transcription factor 3
UniProt Protein Name
Pre-B-cell leukemia transcription factor 3
UniProt Gene Name
PBX3
UniProt Entry Name
PBX3_HUMAN

Uniprot Description

PBX3: Transcriptional activator that binds the sequence 5'- ATCAATCAA-3'. Belongs to the TALE/PBX homeobox family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 9q33.3

Cellular Component: transcription factor complex; nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: dorsal spinal cord development; posterior compartment specification; anterior compartment specification; transcription, DNA-dependent; regulation of transcription, DNA-dependent; adult locomotory behavior; neuron development; neurological control of breathing; respiratory gaseous exchange

Research Articles on PBX3

Similar Products

Product Notes

The PBX3 pbx3 (Catalog #AAA6162972) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PBX3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PBX3 pbx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PBX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.