Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.21kD).)

Mouse anti-Human PBX2 Monoclonal Antibody | anti-PBX2 antibody

PBX2 (G17, Pre-B Cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17) (PE)

Gene Names
PBX2; G17; HOX12; PBX2MHC
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PBX2; Monoclonal Antibody; PBX2 (G17; Pre-B Cell Leukemia Transcription Factor 2; Homeobox Protein PBX2; Protein G17) (PE); anti-PBX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E9
Specificity
Recognizes human PBX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PBX2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa351-431 from human PBX2 (NP_002577) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.21kD).)

Western Blot (WB)

(PBX2 monoclonal antibody Western Blot analysis of PBX2 expression in Hela NE.)

Western Blot (WB) (PBX2 monoclonal antibody Western Blot analysis of PBX2 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody. Lane 1: PBX2 transfected lysate (45.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody. Lane 1: PBX2 transfected lysate (45.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PBX2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PBX2 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-PBX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
pre-B-cell leukemia transcription factor 2
NCBI Official Synonym Full Names
PBX homeobox 2
NCBI Official Symbol
PBX2
NCBI Official Synonym Symbols
G17; HOX12; PBX2MHC
NCBI Protein Information
pre-B-cell leukemia transcription factor 2
UniProt Protein Name
Pre-B-cell leukemia transcription factor 2
UniProt Gene Name
PBX2
UniProt Synonym Gene Names
G17

NCBI Description

This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6. [provided by RefSeq, Jul 2008]

Uniprot Description

PBX2: Transcriptional activator that binds the sequence 5'- ATCAATCAA-3'. Activates transcription of PF4 in complex with MEIS1. Belongs to the TALE/PBX homeobox family.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 6p21.32

Cellular Component: nucleus; transcription factor complex

Molecular Function: chromatin binding; protein binding; transcription factor binding

Biological Process: embryonic limb morphogenesis; positive regulation of transcription from RNA polymerase II promoter; proximal/distal pattern formation; transcription from RNA polymerase II promoter

Research Articles on PBX2

Similar Products

Product Notes

The PBX2 pbx2 (Catalog #AAA6159298) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PBX2 (G17, Pre-B Cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PBX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PBX2 pbx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PBX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.