Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PBK is 0.3 ng/ml as a capture antibody.)

Mouse PBK Monoclonal Antibody | anti-PBK antibody

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (Biotin)

Gene Names
PBK; SPK; CT84; TOPK; Nori-3
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PBK; Monoclonal Antibody; PBK (PDZ Binding Kinase; FLJ14385; Nori-3; SPK; TOPK) (Biotin); PDZ Binding Kinase; TOPK; anti-PBK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A3
Specificity
Recognizes PBK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PBK antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PBK (NP_060962.2, 122aa-229aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKAD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PBK is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PBK is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-PBK antibody
This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq]
Product Categories/Family for anti-PBK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,085 Da
NCBI Official Full Name
lymphokine-activated killer T-cell-originated protein kinase
NCBI Official Synonym Full Names
PDZ binding kinase
NCBI Official Symbol
PBK
NCBI Official Synonym Symbols
SPK; CT84; TOPK; Nori-3
NCBI Protein Information
lymphokine-activated killer T-cell-originated protein kinase; PDZ-binding kinase; cancer/testis antigen 84; MAPKK-like protein kinase; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase
UniProt Protein Name
Lymphokine-activated killer T-cell-originated protein kinase
UniProt Gene Name
PBK
UniProt Synonym Gene Names
TOPK; CT84; SPK
UniProt Entry Name
TOPK_HUMAN

NCBI Description

This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

PBK: Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage. Interacts with DLG1 and TP53. Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules. Activated by phosphorylation. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase kinase subfamily.

Protein type: Protein kinase, Other; Cancer Testis Antigen (CTA); Protein kinase, Ser/Thr (non-receptor); EC 2.7.12.2; Kinase, protein; Other group; TOPK family

Chromosomal Location of Human Ortholog: 8p21.2

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: mitosis; negative regulation of protein amino acid phosphorylation; negative regulation of inflammatory response; negative regulation of stress-activated MAPK cascade; protein amino acid phosphorylation; negative regulation of proteasomal ubiquitin-dependent protein catabolic process

Research Articles on PBK

Similar Products

Product Notes

The PBK pbk (Catalog #AAA6171404) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PBK can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PBK pbk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PBK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.