Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PAX8 expression in transfected 293T cell line by PAX8 monoclonal antibody (M23), clone 2F1.Lane 1: PAX8 transfected lysate (48.2 KDa).Lane 2: Non-transfected lysate.)

Mouse PAX8 Monoclonal Antibody | anti-PAX8 antibody

PAX8 (Paired Box 8) (HRP)

Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PAX8; Monoclonal Antibody; PAX8 (Paired Box 8) (HRP); Paired Box 8; anti-PAX8 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F1
Specificity
Recognizes PAX8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PAX8 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PAX8 (NP_003457.1, 141aa-250aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PAX8 expression in transfected 293T cell line by PAX8 monoclonal antibody (M23), clone 2F1.Lane 1: PAX8 transfected lysate (48.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAX8 expression in transfected 293T cell line by PAX8 monoclonal antibody (M23), clone 2F1.Lane 1: PAX8 transfected lysate (48.2 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAX8 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PAX8 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAX8 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PAX8 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-PAX8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,044 Da
NCBI Official Full Name
paired box protein Pax-8 isoform PAX8A
NCBI Official Synonym Full Names
paired box 8
NCBI Official Symbol
PAX8
NCBI Protein Information
paired box protein Pax-8
UniProt Protein Name
Paired box protein Pax-8
Protein Family
UniProt Gene Name
PAX8
UniProt Entry Name
PAX8_HUMAN

Uniprot Description

PAX8: Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells. Interacts with WWTR1. Expressed in the excretory system, thyroid gland and Wilms tumors. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; DNA binding; transcription factor activity; thyroid-stimulating hormone receptor activity

Biological Process: regulation of apoptosis; anatomical structure morphogenesis; inner ear morphogenesis; central nervous system development; transcription, DNA-dependent; ureteric bud branching; positive regulation of transcription, DNA-dependent; thyroid gland development; positive regulation of transcription from RNA polymerase II promoter; mesonephros development; kidney development; pronephros development; urogenital system development

Disease: Hypothyroidism, Congenital, Nongoitrous, 2

Similar Products

Product Notes

The PAX8 pax8 (Catalog #AAA6182461) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PAX8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAX8 pax8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAX8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.