Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PASD1 monoclonal antibody (M06), clone 1G12 Western Blot analysis of PASD1 expression in HeLa.)

Mouse PASD1 Monoclonal Antibody | anti-PASD1 antibody

PASD1 (PAS Domain Containing 1) (APC)

Gene Names
PASD1; CT63; CT64; OXTES1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PASD1; Monoclonal Antibody; PASD1 (PAS Domain Containing 1) (APC); PAS Domain Containing 1; anti-PASD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G12
Specificity
Recognizes PASD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
773
Applicable Applications for anti-PASD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PASD1 (NP_775764, 1aa-100aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PASD1 monoclonal antibody (M06), clone 1G12 Western Blot analysis of PASD1 expression in HeLa.)

Western Blot (WB) (PASD1 monoclonal antibody (M06), clone 1G12 Western Blot analysis of PASD1 expression in HeLa.)
Related Product Information for anti-PASD1 antibody
Mouse monoclonal antibody raised against a full length recombinant PASD1.
Product Categories/Family for anti-PASD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
circadian clock protein PASD1
NCBI Official Synonym Full Names
PAS domain containing repressor 1
NCBI Official Symbol
PASD1
NCBI Official Synonym Symbols
CT63; CT64; OXTES1
NCBI Protein Information
circadian clock protein PASD1
UniProt Protein Name
PAS domain-containing protein 1
Protein Family
UniProt Gene Name
PASD1
UniProt Synonym Gene Names
CT63
UniProt Entry Name
PASD1_HUMAN

NCBI Description

This gene encodes a protein that is thought to function as a transcription factor. The protein is a cancer-associated antigen that can stimulate autologous T-cell responses, and it is therefore considered to be a potential immunotherapeutic target for the treatment of various hematopoietic malignancies, including diffuse large B-cell lymphoma. [provided by RefSeq, May 2010]

Research Articles on PASD1

Similar Products

Product Notes

The PASD1 pasd1 (Catalog #AAA6167886) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PASD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PASD1 pasd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PASD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.