Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human PARK2 Monoclonal Antibody | anti-PARK2 antibody

PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (PE)

Gene Names
PARK2; PDJ; PRKN; AR-JP; LPRS2
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PARK2; Monoclonal Antibody; PARK2 (E3 Ubiquitin-protein Ligase Parkin; PRKN; Parkinson Juvenile Disease Protein 2; Parkinson Disease Protein 2) (PE); anti-PARK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1H4
Specificity
Recognizes human PARK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PARK2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa288-388 from human PARK2 (AAH22014) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(PARK2 monoclonal antibody. Western Blot analysis of PARK2 expression in Jurkat)

Western Blot (WB) (PARK2 monoclonal antibody. Western Blot analysis of PARK2 expression in Jurkat)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-PARK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
~68 kDa
NCBI Official Full Name
Homo sapiens Parkinson disease (autosomal recessive, juvenile) 2, parkin, mRNA
NCBI Official Synonym Full Names
parkinson protein 2, E3 ubiquitin protein ligase (parkin)
NCBI Official Symbol
PARK2
NCBI Official Synonym Symbols
PDJ; PRKN; AR-JP; LPRS2
NCBI Protein Information
E3 ubiquitin-protein ligase parkin; parkinson juvenile disease protein 2; Parkinson disease (autosomal recessive, juvenile) 2, parkin
UniProt Protein Name
E3 ubiquitin-protein ligase parkin
UniProt Gene Name
PARK2
UniProt Synonym Gene Names
PRKN; Parkinson disease protein 2
UniProt Entry Name
PRKN2_HUMAN

NCBI Description

The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. [provided by RefSeq, Jul 2008]

Uniprot Description

PARK2: a component of a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins, such as BCL2, SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP, SEPT5, ZNF746 and AIMP2. Mediates monoubiquitination as well as 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination of substrates depending on the context. Participates in the removal and/or detoxification of abnormally folded or damaged protein by mediating 'Lys-63'-linked polyubiquitination of misfolded proteins such as PARK7: 'Lys-63'- linked polyubiquitinated misfolded proteins are then recognized by HDAC6, leading to their recruitment to aggresomes, followed by degradation. Mediates 'Lys-63'-linked polyubiquitination of SNCAIP, possibly playing a role in Lewy-body formation. Mediates monoubiquitination of BCL2, thereby acting as a positive regulator of autophagy. Promotes the autophagic degradation of dysfunctional depolarized mitochondria. Mediates 'Lys-48'-linked polyubiquitination of ZNF746, followed by degradation of ZNF746 by the proteasome; possibly playing a role in role in regulation of neuron death. Limits the production of reactive oxygen species (ROS). Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin-E during neuronal apoptosis. May represent a tumor suppressor gene. Forms an E3 ubiquitin ligase complex with UBE2L3 or UBE2L6. Mediates 'Lys-63'-linked polyubiquitination by associating with UBE2V1. Part of a SCF-like complex, consisting of PARK2, CUL1 and FBXW7. Part of a complex, including STUB1, HSP70 and GPR37. The amount of STUB1 in the complex increases during ER stress. STUB1 promotes the dissociation of HSP70 from PARK2 and GPR37, thus facilitating PARK2-mediated GPR37 ubiquitination. HSP70 transiently associates with unfolded GPR37 and inhibits the E3 activity of PARK2, whereas, STUB1 enhances the E3 activity of PARK2 through promotion of dissociation of HSP70 from PARK2-GPR37 complexes. Interacts with PSMD4 and PACRG. Interacts with LRRK2. Interacts with RANBP2. Interacts with SUMO1 but not SUMO2, which promotes nuclear localization and autoubiquitination. Interacts (via first RING- type domain) with AIMP2 (via N-terminus). Interacts with PSMA7 and RNF41. Interacts with PINK1. Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis. Found in serum. Belongs to the RBR family. Parkin subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.-; Ligase

Chromosomal Location of Human Ortholog: 6q25.2-q27

Cellular Component: Golgi apparatus; neuron projection; mitochondrion; perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm; SCF ubiquitin ligase complex; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: tubulin binding; identical protein binding; ubiquitin binding; zinc ion binding; histone deacetylase binding; ubiquitin-protein ligase activity; Hsp70 protein binding; actin binding; protein kinase binding; PDZ domain binding; protein binding; G-protein-coupled receptor binding; ubiquitin conjugating enzyme binding; chaperone binding; ubiquitin protein ligase binding; heat shock protein binding; SH3 domain binding; kinase binding; ligase activity

Biological Process: protein monoubiquitination; proteasomal ubiquitin-dependent protein catabolic process; negative regulation of JNK cascade; negative regulation of actin filament bundle formation; protein polyubiquitination; startle response; central nervous system development; adult locomotory behavior; regulation of protein ubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; regulation of neurotransmitter secretion; protein ubiquitination; mitochondrion localization; norepinephrine metabolic process; dopamine metabolic process; regulation of dopamine secretion; negative regulation of insulin secretion; negative regulation of glucokinase activity; zinc ion homeostasis; regulation of lipid transport; negative regulation of protein amino acid phosphorylation; dopamine uptake; negative regulation of neuron apoptosis; positive regulation of DNA binding; synaptic transmission, glutamatergic; mitochondrial fission; mitochondrion organization and biogenesis; protein autoubiquitination; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein stabilization; transcription, DNA-dependent; learning; regulation of protein transport; cellular protein catabolic process; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; mitochondrion degradation; positive regulation of transcription from RNA polymerase II promoter; regulation of autophagy; response to oxidative stress

Disease: Parkinson Disease 2, Autosomal Recessive Juvenile; Leprosy, Susceptibility To, 2; Lung Cancer; Ovarian Cancer

Research Articles on PARK2

Similar Products

Product Notes

The PARK2 park2 (Catalog #AAA6159282) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PARK2 park2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PARK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.