Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PARD3 Monoclonal Antibody | anti-PARD3 antibody

PARD3 (Partitioning Defective 3 Homolog, PAR-3, PARD-3, Atypical PKC Isotype-specific-interacting Protein, ASIP, CTCL Tumor Antigen se2-5, PAR3-alpha, PAR3, PAR3A, Bazooka, FLJ21015, SE2-5L16, SE2-5LT1, SE2-5T2) (FITC)

Gene Names
PARD3; Baz; ASIP; PAR3; PARD-3; PARD3A; SE2-5T2; PPP1R118; SE2-5L16; SE2-5LT1; PAR3alpha
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PARD3; Monoclonal Antibody; PARD3 (Partitioning Defective 3 Homolog; PAR-3; PARD-3; Atypical PKC Isotype-specific-interacting Protein; ASIP; CTCL Tumor Antigen se2-5; PAR3-alpha; PAR3; PAR3A; Bazooka; FLJ21015; SE2-5L16; SE2-5LT1; SE2-5T2) (FITC); anti-PARD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G5
Specificity
Recognizes human PARD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PARD3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-290 from human PARD3 (AAH11711) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-PARD3 antibody
Adapter protein involved in asymmetrical cell division and cell polarization processes. Seems to play a central role in the formation of epithelial tight junctions. Targets the phosphatase PTEN to cell junctions. Association with PARD6B may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins. Required for establishment of neuronal polarity and normal axon formation in cultured hippocampal neurons.
Product Categories/Family for anti-PARD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
149,695 Da
NCBI Official Full Name
Homo sapiens par-3 partitioning defective 3 homolog (C. elegans), mRNA
NCBI Official Synonym Full Names
par-3 family cell polarity regulator
NCBI Official Symbol
PARD3
NCBI Official Synonym Symbols
Baz; ASIP; PAR3; PARD-3; PARD3A; SE2-5T2; PPP1R118; SE2-5L16; SE2-5LT1; PAR3alpha
NCBI Protein Information
partitioning defective 3 homolog
Protein Family

NCBI Description

This gene encodes a member of the PARD protein family. PARD family members interact with other PARD family members and other proteins; they affect asymmetrical cell division and direct polarized cell growth. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]

Research Articles on PARD3

Similar Products

Product Notes

The PARD3 (Catalog #AAA6148673) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PARD3 (Partitioning Defective 3 Homolog, PAR-3, PARD-3, Atypical PKC Isotype-specific-interacting Protein, ASIP, CTCL Tumor Antigen se2-5, PAR3-alpha, PAR3, PAR3A, Bazooka, FLJ21015, SE2-5L16, SE2-5LT1, SE2-5T2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PARD3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PARD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.