Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human PAPSS1 Monoclonal Antibody | anti-PAPSS1 antibody

PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, SK 1, ATPSK1, PAPSS) (FITC)

Gene Names
PAPSS1; SK1; PAPSS; ATPSK1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAPSS1; Monoclonal Antibody; PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1; PAPS Synthethase 1; Sulfurylase Kinase 1; SK1; SK 1; ATPSK1; PAPSS) (FITC); anti-PAPSS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F4
Specificity
Recognizes human PAPSS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PAPSS1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa144-253 from PAPSS1 (NP_005434) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of PAPSS1 expression in transfected 293T cell line by PAPSS1 monoclonal antibody. Lane 1: PAPSS1 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAPSS1 expression in transfected 293T cell line by PAPSS1 monoclonal antibody. Lane 1: PAPSS1 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAPSS1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PAPSS1 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of PAPSS1 over-expressed 293 cell line, cotransfected with PAPSS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PAPSS1 over-expressed 293 cell line, cotransfected with PAPSS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-PAPSS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70.9 kDa (626aa)
NCBI Official Full Name
bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
NCBI Official Synonym Full Names
3'-phosphoadenosine 5'-phosphosulfate synthase 1
NCBI Official Symbol
PAPSS1
NCBI Official Synonym Symbols
SK1; PAPSS; ATPSK1
NCBI Protein Information
bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
UniProt Protein Name
Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
UniProt Gene Name
PAPSS1
UniProt Synonym Gene Names
ATPSK1; PAPSS; PAPS synthase 1; PAPSS 1; SK 1; SK1; SAT
UniProt Entry Name
PAPS1_HUMAN

NCBI Description

Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).[supplied by OMIM, Mar 2008]

Uniprot Description

PAPSS1: Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yielding 3'-phosphoadenylylsulfate (PAPS: activated sulfate donor used by sulfotransferase). In mammals, PAPS is the sole source of sulfate; APS appears to be only an intermediate in the sulfate- activation pathway. Also involved in the biosynthesis of sulfated L-selectin ligands in endothelial cells.

Protein type: Kinase, other; Other Amino Acids Metabolism - selenoamino acid; Nucleotide Metabolism - purine; EC 2.7.1.25; Energy Metabolism - sulfur; EC 2.7.7.4

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: cytosol

Molecular Function: adenylylsulfate kinase activity; ATP binding; sulfate adenylyltransferase (ATP) activity; nucleotidyltransferase activity

Biological Process: sulfate assimilation; glycosaminoglycan metabolic process; xenobiotic metabolic process; carbohydrate metabolic process; pathogenesis; phosphorylation; skeletal development; 3'-phosphoadenosine 5'-phosphosulfate biosynthetic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on PAPSS1

Similar Products

Product Notes

The PAPSS1 papss1 (Catalog #AAA6148668) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, SK 1, ATPSK1, PAPSS) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAPSS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAPSS1 papss1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAPSS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.