Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human PANX1 Monoclonal Antibody | anti-PANX1 antibody

PANX1 (MRS1, Pannexin-1, UNQ2529/PRO6028)

Gene Names
PANX1; PX1; MRS1; UNQ2529
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PANX1; Monoclonal Antibody; PANX1 (MRS1; Pannexin-1; UNQ2529/PRO6028); Anti -PANX1 (MRS1; anti-PANX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E3
Specificity
Recognizes human PANX1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSS*
Applicable Applications for anti-PANX1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in Western Blot and ELISA.
Immunogen
Partial recombinant corresponding to aa327-426 from ANX1 with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged PANX1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PANX1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-PANX1 antibody
Structural component of the gap junctions and the hemichannels. May play a role as a Ca2+-leak channel to regulate ER Ca2+ homeostasis.
Product Categories/Family for anti-PANX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,050 Da
NCBI Official Full Name
pannexin-1
NCBI Official Synonym Full Names
pannexin 1
NCBI Official Symbol
PANX1
NCBI Official Synonym Symbols
PX1; MRS1; UNQ2529
NCBI Protein Information
pannexin-1; innexin
UniProt Protein Name
Pannexin-1
Protein Family
UniProt Gene Name
PANX1
UniProt Synonym Gene Names
MRS1
UniProt Entry Name
PANX1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties. [provided by RefSeq, Jul 2008]

Uniprot Description

PANX1: Structural component of the gap junctions and the hemichannels. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis. Belongs to the pannexin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cell adhesion

Chromosomal Location of Human Ortholog: 11q21

Cellular Component: endoplasmic reticulum membrane; protein complex; membrane; endoplasmic reticulum; gap junction; integral to membrane; plasma membrane

Molecular Function: actin filament binding; protease binding; leak channel activity; protein heterodimerization activity; calcium channel activity; gap junction hemi-channel activity; receptor binding

Biological Process: positive regulation of interleukin-1 alpha secretion; synaptic transmission; calcium ion transport; innate immune response; positive regulation of interleukin-1 beta secretion; response to ATP; cation transport

Research Articles on PANX1

Similar Products

Product Notes

The PANX1 panx1 (Catalog #AAA6011925) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PANX1 (MRS1, Pannexin-1, UNQ2529/PRO6028) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PANX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in Western Blot and ELISA. Researchers should empirically determine the suitability of the PANX1 panx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DLSLYNLFLE ENISEVKSYK CLKVLENIKS SGQGIDPMLL LTNLGMIKMD VVDGKTPMSA EMREEQGNQT AELQGMNIDS ETKANNGEKN ARQRLLDSS*. It is sometimes possible for the material contained within the vial of "PANX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.